NCOA2 (nuclear receptor coactivator 2)

Gene

• Entrez ID: 10499
• Gene name: Nuclear receptor coactivator 2
• Gene symbol: NCOA2
• Synonyms (NCBI Gene): GRIP1, KAT13C, NCoA-2, SRC2, TIF2, bHLHe75
• Chromosome: 8
• Chromosome location: 8q13.3
• Summary: The protein encoded by this gene functions as a transcriptional coactivator for nuclear hormone receptors, including steroid, thyroid, retinoid, and vitamin D receptors. The encoded protein acts as an intermediary factor for the ligand-dependent activity

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004004	hsa-miR-137	Luciferase reporter assay, qRT-PCR, Western blot	18381414
MIRT041215	hsa-miR-193b-3p	CLASH	23622248
MIRT501843	hsa-miR-200c-3p	PAR-CLIP	24398324
MIRT501842	hsa-miR-200b-3p	PAR-CLIP	24398324
MIRT501841	hsa-miR-429	PAR-CLIP	24398324
MIRT501840	hsa-miR-3120-3p	PAR-CLIP	24398324
MIRT501839	hsa-miR-6750-5p	PAR-CLIP	24398324
MIRT501838	hsa-miR-6822-5p	PAR-CLIP	24398324
MIRT501837	hsa-miR-7515	PAR-CLIP	24398324
MIRT501836	hsa-miR-3179	PAR-CLIP	24398324
MIRT501835	hsa-miR-539-5p	PAR-CLIP	24398324
MIRT501833	hsa-miR-4471	PAR-CLIP	24398324
MIRT501834	hsa-miR-8059	PAR-CLIP	24398324
MIRT501832	hsa-miR-6864-5p	PAR-CLIP	24398324
MIRT440136	hsa-miR-1185-5p	HITS-CLIP	24374217
MIRT440135	hsa-miR-544a	HITS-CLIP	24374217
MIRT440136	hsa-miR-1185-5p	HITS-CLIP	24374217
MIRT440135	hsa-miR-544a	HITS-CLIP	24374217
MIRT501842	hsa-miR-200b-3p	PAR-CLIP	27292025
MIRT501843	hsa-miR-200c-3p	PAR-CLIP	27292025
MIRT501840	hsa-miR-3120-3p	PAR-CLIP	27292025
MIRT501836	hsa-miR-3179	PAR-CLIP	27292025
MIRT501841	hsa-miR-429	PAR-CLIP	27292025
MIRT501833	hsa-miR-4471	PAR-CLIP	27292025
MIRT501835	hsa-miR-539-5p	PAR-CLIP	27292025
MIRT501839	hsa-miR-6750-5p	PAR-CLIP	27292025
MIRT501838	hsa-miR-6822-5p	PAR-CLIP	27292025
MIRT501832	hsa-miR-6864-5p	PAR-CLIP	27292025
MIRT501837	hsa-miR-7515	PAR-CLIP	27292025
MIRT501834	hsa-miR-8059	PAR-CLIP	27292025
MIRT501843	hsa-miR-200c-3p	PAR-CLIP	24398324
MIRT501842	hsa-miR-200b-3p	PAR-CLIP	24398324
MIRT501841	hsa-miR-429	PAR-CLIP	24398324
MIRT501840	hsa-miR-3120-3p	PAR-CLIP	24398324
MIRT501839	hsa-miR-6750-5p	PAR-CLIP	24398324
MIRT501838	hsa-miR-6822-5p	PAR-CLIP	24398324
MIRT501837	hsa-miR-7515	PAR-CLIP	24398324
MIRT501836	hsa-miR-3179	PAR-CLIP	24398324
MIRT501835	hsa-miR-539-5p	PAR-CLIP	24398324
MIRT501833	hsa-miR-4471	PAR-CLIP	24398324
MIRT501834	hsa-miR-8059	PAR-CLIP	24398324
MIRT501832	hsa-miR-6864-5p	PAR-CLIP	24398324
MIRT1176726	hsa-miR-125a-3p	CLIP-seq
MIRT1176727	hsa-miR-1292	CLIP-seq
MIRT1176728	hsa-miR-181a	CLIP-seq
MIRT1176729	hsa-miR-181b	CLIP-seq
MIRT1176730	hsa-miR-181c	CLIP-seq
MIRT1176731	hsa-miR-181d	CLIP-seq
MIRT1176732	hsa-miR-1976	CLIP-seq
MIRT1176733	hsa-miR-223	CLIP-seq
MIRT1176734	hsa-miR-3064-3p	CLIP-seq
MIRT1176735	hsa-miR-3120-5p	CLIP-seq
MIRT1176736	hsa-miR-3121-3p	CLIP-seq
MIRT1176737	hsa-miR-3152-5p	CLIP-seq
MIRT1176738	hsa-miR-3185	CLIP-seq
MIRT1176739	hsa-miR-346	CLIP-seq
MIRT1176740	hsa-miR-3620	CLIP-seq
MIRT1176741	hsa-miR-362-5p	CLIP-seq
MIRT1176742	hsa-miR-3646	CLIP-seq
MIRT1176743	hsa-miR-3647-3p	CLIP-seq
MIRT1176744	hsa-miR-3660	CLIP-seq
MIRT1176745	hsa-miR-3685	CLIP-seq
MIRT1176746	hsa-miR-3918	CLIP-seq
MIRT1176747	hsa-miR-3934	CLIP-seq
MIRT1176748	hsa-miR-3940-5p	CLIP-seq
MIRT1176749	hsa-miR-4259	CLIP-seq
MIRT1176750	hsa-miR-4262	CLIP-seq
MIRT1176751	hsa-miR-4266	CLIP-seq
MIRT1176752	hsa-miR-4288	CLIP-seq
MIRT1176753	hsa-miR-4292	CLIP-seq
MIRT1176754	hsa-miR-433	CLIP-seq
MIRT1176755	hsa-miR-4421	CLIP-seq
MIRT1176756	hsa-miR-4475	CLIP-seq
MIRT1176757	hsa-miR-448	CLIP-seq
MIRT1176758	hsa-miR-4507	CLIP-seq
MIRT1176759	hsa-miR-4526	CLIP-seq
MIRT1176760	hsa-miR-4640-5p	CLIP-seq
MIRT1176761	hsa-miR-4646-5p	CLIP-seq
MIRT1176762	hsa-miR-4650-5p	CLIP-seq
MIRT1176763	hsa-miR-4659a-3p	CLIP-seq
MIRT1176764	hsa-miR-4659b-3p	CLIP-seq
MIRT1176765	hsa-miR-4685-5p	CLIP-seq
MIRT1176766	hsa-miR-4699-3p	CLIP-seq
MIRT1176767	hsa-miR-4708-5p	CLIP-seq
MIRT1176768	hsa-miR-4722-3p	CLIP-seq
MIRT1176769	hsa-miR-4726-5p	CLIP-seq
MIRT1176770	hsa-miR-4728-3p	CLIP-seq
MIRT1176771	hsa-miR-4755-3p	CLIP-seq
MIRT1176772	hsa-miR-4760-3p	CLIP-seq
MIRT1176773	hsa-miR-4774-3p	CLIP-seq
MIRT1176774	hsa-miR-4775	CLIP-seq
MIRT1176775	hsa-miR-487a	CLIP-seq
MIRT1176776	hsa-miR-494	CLIP-seq
MIRT1176777	hsa-miR-498	CLIP-seq
MIRT1176778	hsa-miR-500b	CLIP-seq
MIRT1176779	hsa-miR-501-5p	CLIP-seq
MIRT1176780	hsa-miR-505	CLIP-seq
MIRT1176781	hsa-miR-513c	CLIP-seq
MIRT1176782	hsa-miR-514b-5p	CLIP-seq
MIRT1176783	hsa-miR-520d-5p	CLIP-seq
MIRT1176784	hsa-miR-524-5p	CLIP-seq
MIRT1176785	hsa-miR-626	CLIP-seq
MIRT1176786	hsa-miR-632	CLIP-seq
MIRT1176787	hsa-miR-651	CLIP-seq
MIRT1176788	hsa-miR-659	CLIP-seq
MIRT1176789	hsa-miR-764	CLIP-seq
MIRT1176790	hsa-miR-767-3p	CLIP-seq
MIRT1176791	hsa-miR-942	CLIP-seq
MIRT1176792	hsa-miR-944	CLIP-seq
MIRT2051186	hsa-miR-1323	CLIP-seq
MIRT2051187	hsa-miR-2110	CLIP-seq
MIRT2051188	hsa-miR-2115	CLIP-seq
MIRT2051189	hsa-miR-3686	CLIP-seq
MIRT2051190	hsa-miR-4271	CLIP-seq
MIRT2051191	hsa-miR-4457	CLIP-seq
MIRT2051192	hsa-miR-4494	CLIP-seq
MIRT2051193	hsa-miR-4667-5p	CLIP-seq
MIRT2051194	hsa-miR-4700-5p	CLIP-seq
MIRT2051195	hsa-miR-4725-3p	CLIP-seq
MIRT2051196	hsa-miR-513b	CLIP-seq
MIRT2051197	hsa-miR-516a-3p	CLIP-seq
MIRT2051198	hsa-miR-548o	CLIP-seq
MIRT2051199	hsa-miR-577	CLIP-seq
MIRT2051200	hsa-miR-582-3p	CLIP-seq
MIRT2051201	hsa-miR-624	CLIP-seq
MIRT1176732	hsa-miR-1976	CLIP-seq
MIRT2280327	hsa-miR-2052	CLIP-seq
MIRT2051188	hsa-miR-2115	CLIP-seq
MIRT1176734	hsa-miR-3064-3p	CLIP-seq
MIRT1176736	hsa-miR-3121-3p	CLIP-seq
MIRT2280328	hsa-miR-3124-3p	CLIP-seq
MIRT2280329	hsa-miR-3144-3p	CLIP-seq
MIRT2280330	hsa-miR-3155	CLIP-seq
MIRT2280331	hsa-miR-3155b	CLIP-seq
MIRT2280332	hsa-miR-330-3p	CLIP-seq
MIRT2280333	hsa-miR-338-5p	CLIP-seq
MIRT2280334	hsa-miR-342-3p	CLIP-seq
MIRT1176745	hsa-miR-3685	CLIP-seq
MIRT2280335	hsa-miR-3692	CLIP-seq
MIRT2280336	hsa-miR-3924	CLIP-seq
MIRT2280337	hsa-miR-3925-3p	CLIP-seq
MIRT2280338	hsa-miR-409-3p	CLIP-seq
MIRT2280339	hsa-miR-4438	CLIP-seq
MIRT2280340	hsa-miR-4448	CLIP-seq
MIRT2280341	hsa-miR-4463	CLIP-seq
MIRT1176757	hsa-miR-448	CLIP-seq
MIRT2051192	hsa-miR-4494	CLIP-seq
MIRT2280342	hsa-miR-4639-5p	CLIP-seq
MIRT2280343	hsa-miR-4687-5p	CLIP-seq
MIRT2280344	hsa-miR-4699-5p	CLIP-seq
MIRT1176768	hsa-miR-4722-3p	CLIP-seq
MIRT2280345	hsa-miR-4777-3p	CLIP-seq
MIRT2280346	hsa-miR-484	CLIP-seq
MIRT1176775	hsa-miR-487a	CLIP-seq
MIRT2280347	hsa-miR-513a-5p	CLIP-seq
MIRT2051197	hsa-miR-516a-3p	CLIP-seq
MIRT2280348	hsa-miR-548c-3p	CLIP-seq
MIRT2051200	hsa-miR-582-3p	CLIP-seq
MIRT2280349	hsa-miR-627	CLIP-seq
MIRT1176788	hsa-miR-659	CLIP-seq
MIRT2280350	hsa-miR-766	CLIP-seq
MIRT2280351	hsa-miR-875-5p	CLIP-seq
MIRT2578802	hsa-miR-1207-5p	CLIP-seq
MIRT2578803	hsa-miR-1251	CLIP-seq
MIRT1176727	hsa-miR-1292	CLIP-seq
MIRT1176728	hsa-miR-181a	CLIP-seq
MIRT1176729	hsa-miR-181b	CLIP-seq
MIRT1176730	hsa-miR-181c	CLIP-seq
MIRT1176731	hsa-miR-181d	CLIP-seq
MIRT1176734	hsa-miR-3064-3p	CLIP-seq
MIRT1176735	hsa-miR-3120-5p	CLIP-seq
MIRT1176737	hsa-miR-3152-5p	CLIP-seq
MIRT1176738	hsa-miR-3185	CLIP-seq
MIRT2578804	hsa-miR-335	CLIP-seq
MIRT1176739	hsa-miR-346	CLIP-seq
MIRT1176740	hsa-miR-3620	CLIP-seq
MIRT1176744	hsa-miR-3660	CLIP-seq
MIRT1176746	hsa-miR-3918	CLIP-seq
MIRT1176750	hsa-miR-4262	CLIP-seq
MIRT2578805	hsa-miR-4279	CLIP-seq
MIRT1176752	hsa-miR-4288	CLIP-seq
MIRT1176753	hsa-miR-4292	CLIP-seq
MIRT1176755	hsa-miR-4421	CLIP-seq
MIRT2578806	hsa-miR-450b-5p	CLIP-seq
MIRT1176759	hsa-miR-4526	CLIP-seq
MIRT1176760	hsa-miR-4640-5p	CLIP-seq
MIRT1176761	hsa-miR-4646-5p	CLIP-seq
MIRT1176762	hsa-miR-4650-5p	CLIP-seq
MIRT1176765	hsa-miR-4685-5p	CLIP-seq
MIRT1176766	hsa-miR-4699-3p	CLIP-seq
MIRT1176767	hsa-miR-4708-5p	CLIP-seq
MIRT1176769	hsa-miR-4726-5p	CLIP-seq
MIRT1176770	hsa-miR-4728-3p	CLIP-seq
MIRT2578807	hsa-miR-4736	CLIP-seq
MIRT1176771	hsa-miR-4755-3p	CLIP-seq
MIRT2578808	hsa-miR-4763-3p	CLIP-seq
MIRT1176773	hsa-miR-4774-3p	CLIP-seq
MIRT1176777	hsa-miR-498	CLIP-seq
MIRT1176780	hsa-miR-505	CLIP-seq
MIRT2578809	hsa-miR-507	CLIP-seq
MIRT2578810	hsa-miR-557	CLIP-seq
MIRT1176785	hsa-miR-626	CLIP-seq
MIRT1176786	hsa-miR-632	CLIP-seq
MIRT1176790	hsa-miR-767-3p	CLIP-seq
MIRT2578811	hsa-miR-873	CLIP-seq
MIRT2578803	hsa-miR-1251	CLIP-seq
MIRT2685921	hsa-miR-1286	CLIP-seq
MIRT1176727	hsa-miR-1292	CLIP-seq
MIRT1176734	hsa-miR-3064-3p	CLIP-seq
MIRT1176735	hsa-miR-3120-5p	CLIP-seq
MIRT1176737	hsa-miR-3152-5p	CLIP-seq
MIRT1176738	hsa-miR-3185	CLIP-seq
MIRT1176739	hsa-miR-346	CLIP-seq
MIRT1176740	hsa-miR-3620	CLIP-seq
MIRT1176746	hsa-miR-3918	CLIP-seq
MIRT1176752	hsa-miR-4288	CLIP-seq
MIRT1176753	hsa-miR-4292	CLIP-seq
MIRT1176755	hsa-miR-4421	CLIP-seq
MIRT1176756	hsa-miR-4475	CLIP-seq
MIRT2685922	hsa-miR-4477b	CLIP-seq
MIRT2578806	hsa-miR-450b-5p	CLIP-seq
MIRT1176760	hsa-miR-4640-5p	CLIP-seq
MIRT1176761	hsa-miR-4646-5p	CLIP-seq
MIRT1176762	hsa-miR-4650-5p	CLIP-seq
MIRT1176765	hsa-miR-4685-5p	CLIP-seq
MIRT1176766	hsa-miR-4699-3p	CLIP-seq
MIRT1176767	hsa-miR-4708-5p	CLIP-seq
MIRT2685923	hsa-miR-4722-5p	CLIP-seq
MIRT1176769	hsa-miR-4726-5p	CLIP-seq
MIRT1176770	hsa-miR-4728-3p	CLIP-seq
MIRT1176771	hsa-miR-4755-3p	CLIP-seq
MIRT1176773	hsa-miR-4774-3p	CLIP-seq
MIRT1176774	hsa-miR-4775	CLIP-seq
MIRT2685924	hsa-miR-495	CLIP-seq
MIRT1176777	hsa-miR-498	CLIP-seq
MIRT1176780	hsa-miR-505	CLIP-seq
MIRT2578809	hsa-miR-507	CLIP-seq
MIRT2578810	hsa-miR-557	CLIP-seq
MIRT1176785	hsa-miR-626	CLIP-seq
MIRT1176786	hsa-miR-632	CLIP-seq
MIRT1176788	hsa-miR-659	CLIP-seq
MIRT1176790	hsa-miR-767-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CTNNB1	Unknown	16141201

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0001162	Function	RNA polymerase II intronic transcription regulatory region sequence-specific DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003712	Function	Transcription coregulator activity	IEA
GO:0003713	Function	Transcription coactivator activity	IBA
GO:0003713	Function	Transcription coactivator activity	IDA	17363140, 22504882, 26553876
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0003713	Function	Transcription coactivator activity	ISS
GO:0003713	Function	Transcription coactivator activity	NAS	9430642
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	11265755, 15563469, 17947383, 21478865, 22504882, 24561505, 28514442, 33640491, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	26733313
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005667	Component	Transcription regulator complex	IPI	9430642, 11265755, 21152046, 26820900
GO:0005737	Component	Cytoplasm	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	8670870
GO:0007623	Process	Circadian rhythm	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010906	Process	Regulation of glucose metabolic process	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0016922	Function	Nuclear receptor binding	IBA
GO:0016922	Function	Nuclear receptor binding	IEA
GO:0016922	Function	Nuclear receptor binding	IPI	10478845, 18798693
GO:0017162	Function	Aryl hydrocarbon receptor binding	IPI	15641800
GO:0019216	Process	Regulation of lipid metabolic process	IEA
GO:0019216	Process	Regulation of lipid metabolic process	ISS
GO:0019904	Function	Protein domain specific binding	IPI	11583620
GO:0032570	Process	Response to progesterone	IEA
GO:0032870	Process	Cellular response to hormone stimulus	IBA
GO:0032922	Process	Circadian regulation of gene expression	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0032991	Component	Protein-containing complex	IMP	15641800
GO:0035357	Process	Peroxisome proliferator activated receptor signaling pathway	NAS	16373399
GO:0042789	Process	MRNA transcription by RNA polymerase II	ISS
GO:0042789	Process	MRNA transcription by RNA polymerase II	NAS	9430642
GO:0045475	Process	Locomotor rhythm	IEA
GO:0045879	Process	Negative regulation of smoothened signaling pathway	IMP	39531503
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	9430642, 11265755
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	EXP	15258145
GO:0090575	Component	RNA polymerase II transcription regulator complex	NAS	9430642
GO:0140416	Function	Transcription regulator inhibitor activity	IDA	39531503
GO:1900076	Process	Regulation of cellular response to insulin stimulus	NAS	16373399
GO:1904017	Process	Cellular response to Thyroglobulin triiodothyronine	IEA
GO:1904179	Process	Positive regulation of adipose tissue development	NAS	16373399

Other IDs

• MIM: 601993
• HGNC: 7669
• e!Ensembl: ENSG00000140396

Protein

• UniProt ID: Q15596
• Protein name: Nuclear receptor coactivator 2 (NCoA-2) (Class E basic helix-loop-helix protein 75) (bHLHe75) (Transcriptional intermediary factor 2) (hTIF2)
• Protein function: Transcriptional coactivator for steroid receptors and nuclear receptors (PubMed:23508108, PubMed:8670870, PubMed:9430642, PubMed:22504882, PubMed:26553876). Coactivator of the steroid binding domain (AF-2) but not of the modulating N-terminal do
• PDB: 1GWQ, 1GWR, 1M2Z, 1MV9, 1MVC, 1MZN, 1P93, 1T63, 1T65, 1UHL, 1YOK, 1ZDT, 1ZDU, 1ZKY, 2AO6, 2B1V, 2B1Z, 2B23, 2FAI, 2G44, 2G5O, 2LDC, 2P15, 2P1T, 2P1U, 2P1V, 2Q7J, 2Q7L, 2YJD, 2ZXZ, 2ZY0, 3A9E, 3CLD, 3DZU, 3DZY, 3E00, 3E7C, 3E94, 3ERD, 3FUG, 3GN8, 3K22, 3K23, 3KWY, 3KYT, 3L0E, 3L0J, 3L0L, 3O1D, 3O1E, 3OAP
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00989	PAS	115 → 215	PAS fold	Domain
  PF14598	PAS_11	267 → 379		Domain
  PF16665	NCOA_u2	463 → 587		Disordered
  PF08832	SRC-1	636 → 709	Steroid receptor coactivator	Domain
  PF16279	DUF4927	731 → 816	Domain of unknown function (DUF4927)	Family
  PF08815	Nuc_rec_co-act	1071 → 1117	Nuclear receptor coactivator	Domain
  PF07469	DUF1518	1281 → 1338	Domain of unknown function (DUF1518)	Domain

• Sequence:

  MSGMGENTSDPSRAETRKRKECPDQLGPSPKRNTEKRNREQENKYIEELAELIFANFNDI
  DNFNFKPDKCAILKETVKQIRQIKEQEKAAAANIDEVQKSDVSSTGQGVIDKDALGPMML
  EALDGFFFVVNLEGNVVFVSENVTQYLRYNQEELMNKSVYSILHVGDHTEFVKNLLPKSI
  VNGGSWSGEPPRRNSHTFNCRMLVKPLPDSEEEGHDNQEAHQKYETMQCFAVSQPKSIKE
  EGEDLQSCLICVARRVPMKERPVLPSSESFTTRQDLQGKITSLDTSTMRAAMKPGWEDLV
  RRCIQKFHAQHEGESVSYAKRHHHEVLRQGLAFSQIYRFSLSDGTLVAAQTKSKLIRSQT
  TNEPQLVISLHMLHREQNVCVMNPDLTGQTMGKPLNPISSNSPAHQALCSGNPGQDMTLS
  SNINFPINGPKEQMGMPMGRFGGSGGMNHVSGMQATTPQGSNYALKMNSPSQSSPGMNPG
  QPTSMLSPRHRMSPGVAGSPRIPPSQFSPAGSLHSPVGVCSSTGNSHSYTNSSLNALQAL
  SEGHGVSLGSSLASPDLKMGNLQNSPVNMNPPPLSKMGSLDSKDCFGLYGEPSEGTTGQA
  ESSCHPGEQKETNDPNLPPAVSSERADGQSRLHDSKGQTKLLQLLTTKSDQMEPSPLASS
  LSDTNKDSTGSLPGSGSTHGTSLKEKHKILHRLLQDSSSPVDLAKLTAEATGKDLSQESS
  STAPGSEVTIKQEPVSPKKKENALLRYLLDKDDTKDIGLPEITPKLERLDSKTDPASNTK
  LIAMKTEKEEMSFEPGDQPGSELDNLEEILDDLQNSQLPQLFPDTRPGAPAGSVDKQAII
  NDLMQLTAENSPVTPVGAQKTALRISQSTFNNPRPGQLGRLLPNQNLPLDITLQSPTGAG
  PFPPIRNSSPYSVIPQPGMMGNQGMIGNQGNLGNSSTGMIGNSASRPTMPSGEWAPQSSA
  VRVTCAATTSAMNRPVQGGMIRNPAASIPMRPSSQPGQRQTLQSQVMNIGPSELEMNMGG
  PQYSQQQAPPNQTAPWPESILPIDQASFASQNRQPFGSSPDDLLCPHPAAESPSDEGALL
  DQLYLALRNFDGLEEIDRALGIPELVSQSQAVDPEQFSSQDSNIMLEQKAPVFPQQYASQ
  AQMAQGSYSPMQDPNFHTMGQRPSYATLRMQPRPGLRPTGLVQNQPNQLRLQLQHRLQAQ
  QNRQPLMNQISNVSNVNLTLRPGVPTQAPINAQMLAQRQREILNQHLRQRQMHQQQQVQQ
  RTLMMRGQGLNMTPSMVAPSGMPATMSNPRIPQANAQQFPFPPNYGISQQPDPGFTGATT
  PQSPLMSPRMAHTQSPMMQQSQANPAYQAPSDINGWAQGNMGGNSMFSQQSPPHFGQQAN
  TSMYSNNMNINVSMATNTGGMSSMNQMTGQISMTSVTSVPTSGLSSMGPEQVNDPALRGG
  NLFPNQLPGMDMIKQEGDTTRKYC

• Sequence length: 1464

Pathways

KEGG:

Estrogen signaling pathway
Thyroid hormone signaling pathway

Reactome:

RORA activates gene expression
Recycling of bile acids and salts
Synthesis of bile acids and bile salts
Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol
Synthesis of bile acids and bile salts via 27-hydroxycholesterol
PPARA activates gene expression
Endogenous sterols
Transcriptional activation of mitochondrial biogenesis
Activation of gene expression by SREBF (SREBP)
HATs acetylate histones
Transcriptional regulation of white adipocyte differentiation
Regulation of lipid metabolism by PPARalpha
Circadian Clock
Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3
Estrogen-dependent gene expression

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SMALL CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	18281529, 26766589, 9731070		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	10459350		★☆☆☆☆ Found in Text Mining only
Acute myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	12964013		★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	24213582, 31553442		★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	15486055, 23707616		★☆☆☆☆ Found in Text Mining only
Angiofibroma	Angiofibroma	BEFREE	22337624, 24856853, 24888778, 27633981, 28639284, 28759137, 30179902		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18521745, 20920219, 21059860, 24304549, 30048685, 30941313		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	20332317		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19095746, 20920219, 21059860, 23936147, 24282087, 24304549, 27107013	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cap Myopathy	Cap myopathy	Pubtator	27606620	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	34837064	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	23463663, 26501226, 29218853, 30179902, 34067464, 35452896, 38607246	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28966239		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	36302831	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	34398873	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	17805042		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	22034177		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma Mesenchymal	Chondrosarcoma	Pubtator	22034177, 23185413, 24839999, 30819134, 34837064, 35342947, 35672279, 37225644, 40301759	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25823027		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18360708	Inhibit	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	20374707, 24839999		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	26261634		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	26261634	Associate	★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	BEFREE	19953635, 24213582		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	22876322, 30177747		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	22876322, 30177747	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial stromal sarcoma, high grade	Endometrial Stromal Sarcoma	BEFREE	29218853		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	27432117		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	20124487		★☆☆☆☆ Found in Text Mining only
Generalized Thyroid Hormone Resistance	Thyroid Hormone Resistance	BEFREE	24550004		★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	17635946		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	35672279	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	24124145		★☆☆☆☆ Found in Text Mining only
Histiocytosis haematophagic	Histiocytosis Haematophagic	BEFREE	17805042		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30089865		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	10803578		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	27560795	Stimulate	★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	31751430		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	30179902	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	11342350, 17694082, 18281529, 20418886, 22337624, 24258712		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	18281529		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	22337624	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	9558366, 9731070	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10459350, 12676584, 15147375, 15607963, 15657427, 17805042, 18754862, 20418886, 24258712, 9558366		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	12676584		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24282087, 27432117		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	28273073		★☆☆☆☆ Found in Text Mining only
Malabsorption Syndrome	Malabsorption Syndrome	BEFREE	21195347		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18521745, 20920219, 21059860, 24304549, 30048685, 30941313		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	20332317		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	22876322, 30177747		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	22556267, 28273073, 29641518		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12237244, 15663989, 16598769, 17079484, 19240160, 20579941, 26799514, 30109944		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	12237244		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15607956, 17079484, 20374707, 23559371, 24304549, 30177747		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	20332317		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18174919		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	20332317		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	21059860		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	20332317		★☆☆☆☆ Found in Text Mining only
Mesenchymal Chondrosarcoma	Mesenchymal Chondrosarcoma	BEFREE	22034177, 23185413, 23252872, 24124145, 24839999, 27544802, 29559236, 30179902, 30819134		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	22011668	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	27432117		★☆☆☆☆ Found in Text Mining only
Mixed phenotype acute leukemia	Mixed Phenotype Leukemia	BEFREE	17697320, 9731070		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	24839999	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASCAT_DG	24076602		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neck Neoplasms	Neck Neoplasms	BEFREE	24839999		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15133472, 16921507, 20579941, 21088497, 21735116, 22556267, 22695118, 24124145, 24213582, 24839999, 24856853, 26501226, 26799514, 27633981, 28273073, 28639284, 28759137, 29218853, 30720533, 30829729, 31464709		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	27432117		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	27432117		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	10690532		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	26261634		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26261634	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	24282087		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	30273195, 31464709, 37221583, 37406360	Associate	★☆☆☆☆ Found in Text Mining only
Pelvic Inflammatory Disease	Pelvic inflammatory disease	Pubtator	24220311	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	30177747	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12237244, 15663989, 16598769, 17079484, 19240160, 20579941, 26799514, 30109944		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	12237244		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	14662770		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19240160, 21088497, 27225190	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27606620	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	20081107	Associate	★☆☆☆☆ Found in Text Mining only
Reifenstein Syndrome	Reifenstein Syndrome	BEFREE	18656523		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	19953635, 23463663, 30720533, 33574497, 38607246	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	24213582, 29559236, 31696361		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma 1	Rhabdomyosarcoma	Pubtator	34067464	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	22337624, 24856853		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	22337624, 29104083, 29218853, 30179902, 33574497	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma of kidney	Sarcoma Of Kidney	BEFREE	30179902		★☆☆☆☆ Found in Text Mining only
Sarcoma, Spindle Cell	Sarcoma	BEFREE	30179902		★☆☆☆☆ Found in Text Mining only
Solitary fibrous tumor	Solitary fibrous tumor	BEFREE	24856853, 28759137		★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	30177747	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	20124487		★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Uterine neoplasm	Pubtator	30273195, 31464709	Associate	★☆☆☆☆ Found in Text Mining only