Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	10494
Gene name	Serine/threonine kinase 25
Gene symbol	STK25
Synonyms (NCBI Gene)	SOK1YSK1
Chromosome	2
Chromosome location	2q37.3
Summary	This gene encodes a member of the germinal centre kinase III (GCK III) subfamily of the sterile 20 superfamily of kinases. The encoded enzyme plays a role in serine-threonine liver kinase B1 (LKB1) signaling pathway to regulate neuronal polarization and m

150

Show/Hide all (150)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049469	hsa-miR-92a-3p	CLASH	23622248
MIRT044928	hsa-miR-186-5p	CLASH	23622248
MIRT723640	hsa-miR-4681	HITS-CLIP	19536157
MIRT723639	hsa-miR-1179	HITS-CLIP	19536157
MIRT723638	hsa-miR-4310	HITS-CLIP	19536157
MIRT723637	hsa-miR-7157-5p	HITS-CLIP	19536157
MIRT723636	hsa-miR-338-3p	HITS-CLIP	19536157
MIRT723635	hsa-miR-6734-3p	HITS-CLIP	19536157
MIRT723634	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT723633	hsa-miR-6868-3p	HITS-CLIP	19536157
MIRT629769	hsa-miR-1245a	HITS-CLIP	23824327
MIRT629768	hsa-miR-8079	HITS-CLIP	23824327
MIRT629767	hsa-miR-7151-5p	HITS-CLIP	23824327
MIRT629766	hsa-miR-6513-3p	HITS-CLIP	23824327
MIRT629765	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT629764	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT629763	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT629762	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT629761	hsa-miR-5001-3p	HITS-CLIP	23824327
MIRT629760	hsa-miR-640	HITS-CLIP	23824327
MIRT723640	hsa-miR-4681	HITS-CLIP	19536157
MIRT723639	hsa-miR-1179	HITS-CLIP	19536157
MIRT723638	hsa-miR-4310	HITS-CLIP	19536157
MIRT723637	hsa-miR-7157-5p	HITS-CLIP	19536157
MIRT723636	hsa-miR-338-3p	HITS-CLIP	19536157
MIRT723635	hsa-miR-6734-3p	HITS-CLIP	19536157
MIRT723634	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT723633	hsa-miR-6868-3p	HITS-CLIP	19536157
MIRT629769	hsa-miR-1245a	HITS-CLIP	23824327
MIRT629768	hsa-miR-8079	HITS-CLIP	23824327
MIRT629767	hsa-miR-7151-5p	HITS-CLIP	23824327
MIRT629766	hsa-miR-6513-3p	HITS-CLIP	23824327
MIRT629765	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT629764	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT629763	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT629762	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT629761	hsa-miR-5001-3p	HITS-CLIP	23824327
MIRT629760	hsa-miR-640	HITS-CLIP	23824327
MIRT1397605	hsa-miR-101	CLIP-seq
MIRT1397606	hsa-miR-1197	CLIP-seq
MIRT1397607	hsa-miR-2681	CLIP-seq
MIRT1397608	hsa-miR-296-5p	CLIP-seq
MIRT1397609	hsa-miR-3166	CLIP-seq
MIRT1397610	hsa-miR-3187-3p	CLIP-seq
MIRT1397611	hsa-miR-3200-5p	CLIP-seq
MIRT1397612	hsa-miR-326	CLIP-seq
MIRT1397613	hsa-miR-330-5p	CLIP-seq
MIRT1397614	hsa-miR-3591-3p	CLIP-seq
MIRT1397615	hsa-miR-4436a	CLIP-seq
MIRT1397616	hsa-miR-4457	CLIP-seq
MIRT1397617	hsa-miR-4488	CLIP-seq
MIRT1397618	hsa-miR-4519	CLIP-seq
MIRT1397619	hsa-miR-4529-5p	CLIP-seq
MIRT1397620	hsa-miR-4539	CLIP-seq
MIRT1397621	hsa-miR-4667-5p	CLIP-seq
MIRT1397622	hsa-miR-4697-5p	CLIP-seq
MIRT1397623	hsa-miR-4700-5p	CLIP-seq
MIRT1397624	hsa-miR-4762-5p	CLIP-seq
MIRT1397625	hsa-miR-483-3p	CLIP-seq
MIRT1397626	hsa-miR-495	CLIP-seq
MIRT1397627	hsa-miR-637	CLIP-seq
MIRT2119036	hsa-miR-1255a	CLIP-seq
MIRT2119037	hsa-miR-1255b	CLIP-seq
MIRT2119038	hsa-miR-1299	CLIP-seq
MIRT2119039	hsa-miR-2116	CLIP-seq
MIRT2119040	hsa-miR-3065-3p	CLIP-seq
MIRT2119041	hsa-miR-3123	CLIP-seq
MIRT2119042	hsa-miR-3190	CLIP-seq
MIRT2119043	hsa-miR-3202	CLIP-seq
MIRT2119044	hsa-miR-3607-5p	CLIP-seq
MIRT2119045	hsa-miR-3622b-5p	CLIP-seq
MIRT2119046	hsa-miR-3661	CLIP-seq
MIRT2119047	hsa-miR-3691-3p	CLIP-seq
MIRT2119048	hsa-miR-3925-5p	CLIP-seq
MIRT2119049	hsa-miR-425	CLIP-seq
MIRT2119050	hsa-miR-4277	CLIP-seq
MIRT2119051	hsa-miR-4299	CLIP-seq
MIRT2119052	hsa-miR-4428	CLIP-seq
MIRT2119053	hsa-miR-4533	CLIP-seq
MIRT2119054	hsa-miR-4651	CLIP-seq
MIRT2119055	hsa-miR-4720-5p	CLIP-seq
MIRT2119056	hsa-miR-4731-3p	CLIP-seq
MIRT2119057	hsa-miR-4773	CLIP-seq
MIRT2119058	hsa-miR-4782-5p	CLIP-seq
MIRT2119059	hsa-miR-4799-3p	CLIP-seq
MIRT2119060	hsa-miR-4801	CLIP-seq
MIRT2119061	hsa-miR-516b	CLIP-seq
MIRT2119062	hsa-miR-543	CLIP-seq
MIRT2119063	hsa-miR-608	CLIP-seq
MIRT2119064	hsa-miR-631	CLIP-seq
MIRT2119065	hsa-miR-642b	CLIP-seq
MIRT2119066	hsa-miR-765	CLIP-seq
MIRT1397605	hsa-miR-101	CLIP-seq
MIRT2341359	hsa-miR-1205	CLIP-seq
MIRT1397607	hsa-miR-2681	CLIP-seq
MIRT1397609	hsa-miR-3166	CLIP-seq
MIRT1397610	hsa-miR-3187-3p	CLIP-seq
MIRT1397614	hsa-miR-3591-3p	CLIP-seq
MIRT1397616	hsa-miR-4457	CLIP-seq
MIRT2341360	hsa-miR-4468	CLIP-seq
MIRT1397619	hsa-miR-4529-5p	CLIP-seq
MIRT1397624	hsa-miR-4762-5p	CLIP-seq
MIRT2341361	hsa-miR-556-5p	CLIP-seq
MIRT1397605	hsa-miR-101	CLIP-seq
MIRT1397606	hsa-miR-1197	CLIP-seq
MIRT2635339	hsa-miR-1224-3p	CLIP-seq
MIRT2635340	hsa-miR-146b-3p	CLIP-seq
MIRT2635341	hsa-miR-2277-3p	CLIP-seq
MIRT1397607	hsa-miR-2681	CLIP-seq
MIRT1397608	hsa-miR-296-5p	CLIP-seq
MIRT2635342	hsa-miR-3152-5p	CLIP-seq
MIRT1397609	hsa-miR-3166	CLIP-seq
MIRT2635343	hsa-miR-3173-5p	CLIP-seq
MIRT1397610	hsa-miR-3187-3p	CLIP-seq
MIRT1397612	hsa-miR-326	CLIP-seq
MIRT1397613	hsa-miR-330-5p	CLIP-seq
MIRT1397614	hsa-miR-3591-3p	CLIP-seq
MIRT2635344	hsa-miR-4286	CLIP-seq
MIRT2635345	hsa-miR-4423-5p	CLIP-seq
MIRT1397615	hsa-miR-4436a	CLIP-seq
MIRT1397616	hsa-miR-4457	CLIP-seq
MIRT2341360	hsa-miR-4468	CLIP-seq
MIRT1397617	hsa-miR-4488	CLIP-seq
MIRT1397619	hsa-miR-4529-5p	CLIP-seq
MIRT1397621	hsa-miR-4667-5p	CLIP-seq
MIRT1397622	hsa-miR-4697-5p	CLIP-seq
MIRT1397623	hsa-miR-4700-5p	CLIP-seq
MIRT2119056	hsa-miR-4731-3p	CLIP-seq
MIRT1397624	hsa-miR-4762-5p	CLIP-seq
MIRT2119060	hsa-miR-4801	CLIP-seq
MIRT1397625	hsa-miR-483-3p	CLIP-seq
MIRT2341361	hsa-miR-556-5p	CLIP-seq
MIRT1397627	hsa-miR-637	CLIP-seq
MIRT2119065	hsa-miR-642b	CLIP-seq
MIRT2635346	hsa-miR-874	CLIP-seq
MIRT1397605	hsa-miR-101	CLIP-seq
MIRT2635341	hsa-miR-2277-3p	CLIP-seq
MIRT1397607	hsa-miR-2681	CLIP-seq
MIRT1397608	hsa-miR-296-5p	CLIP-seq
MIRT1397609	hsa-miR-3166	CLIP-seq
MIRT1397610	hsa-miR-3187-3p	CLIP-seq
MIRT1397614	hsa-miR-3591-3p	CLIP-seq
MIRT1397616	hsa-miR-4457	CLIP-seq
MIRT2341360	hsa-miR-4468	CLIP-seq
MIRT1397619	hsa-miR-4529-5p	CLIP-seq
MIRT2119056	hsa-miR-4731-3p	CLIP-seq
MIRT1397624	hsa-miR-4762-5p	CLIP-seq
MIRT2119060	hsa-miR-4801	CLIP-seq
MIRT2341361	hsa-miR-556-5p	CLIP-seq
MIRT2119065	hsa-miR-642b	CLIP-seq

Show/Hide all (38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	TAS	9160885
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	15037601, 16189514, 17657516, 18782753, 20332113, 21423148, 21516116, 21561863, 22652780, 23455922, 23665169, 25416956, 26871637, 27107012, 28514442, 31515488, 32296183, 32707033, 33961781, 35271311
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	22652780
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA	22652780
GO:0005794	Component	Golgi apparatus	IEA
GO:0006468	Process	Protein phosphorylation	IDA	17657516
GO:0006979	Process	Response to oxidative stress	TAS	8887545
GO:0007163	Process	Establishment or maintenance of cell polarity	IEA
GO:0007165	Process	Signal transduction	TAS	8887545
GO:0007409	Process	Axonogenesis	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0032874	Process	Positive regulation of stress-activated MAPK cascade	IDA	22652780
GO:0034599	Process	Cellular response to oxidative stress	IDA	22291017
GO:0034599	Process	Cellular response to oxidative stress	IEA
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0036481	Process	Intrinsic apoptotic signaling pathway in response to hydrogen peroxide	IGI	22652780
GO:0042803	Function	Protein homodimerization activity	IDA	15037601
GO:0046777	Process	Protein autophosphorylation	IDA	17657516
GO:0046872	Function	Metal ion binding	IEA
GO:0050772	Process	Positive regulation of axonogenesis	IEA
GO:0051645	Process	Golgi localization	IDA	15037601
GO:0051645	Process	Golgi localization	IEA
GO:0051645	Process	Golgi localization	IEA
GO:0051683	Process	Establishment of Golgi localization	IMP	20332113
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0090168	Process	Golgi reassembly	IMP	20332113
GO:0090443	Component	FAR/SIN/STRIPAK complex	IDA	18782753
GO:0090443	Component	FAR/SIN/STRIPAK complex	IEA
GO:0106310	Function	Protein serine kinase activity	IEA

MIM	HGNC	e!Ensembl
602255	11404	ENSG00000115694

O00506

Protein name

Serine/threonine-protein kinase 25 (EC 2.7.11.1) (Ste20-like kinase) (Sterile 20/oxidant stress-response kinase 1) (SOK-1) (Ste20/oxidant stress response kinase 1)

Protein function

Oxidant stress-activated serine/threonine kinase that may play a role in the response to environmental stress. Targets to the Golgi apparatus where it appears to regulate protein transport events, cell adhesion, and polarity complexes important

PDB

2XIK , 3W8H , 4NZW , 7Z4V

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	20 → 270	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed. Highest levels are found in testis, large intestine, brain and stomach followed by heart and lung.

Sequence

MAHLRGFANQHSRVDPEELFTKLDRIGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAEDEI
EDIQQEITVLSQCDSPYITRYFGSYLKSTKLWIIMEYLGGGSALDLLKPGPLEETYIATI
LREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPF
WMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNSPPTLEGQHS
KPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTSFLTELIDRYKRWKSEGHGEESS
SEDSDIDGEAEDGEQGPIWTFPPTIRPSPHSKLHKGTALHSSQKPAEPVKRQPRSQCLST
LVRPVFGELKEKHKQSGGSVGALEELENAFSLAEESCPGISDKLMVHLVERVQRFSHNRN
HLTSTR

Sequence length

426

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (29)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arteriosclerosis	Arteriosclerosis	BEFREE	29930001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29930001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19525980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34795841	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29930001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29996891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	38166604	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	26238961, 38098057	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	26238961	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	27981357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29534578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	26238961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	29930001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30328087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	GWASCAT_DG	30595370		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	36708053	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19525980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	28442507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	26238961	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22782892, 29996891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	22782892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	29930001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic Diseases	BEFREE	28442507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	25550858	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25550858	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohypoparathyroidism	Pseudohypoparathyroidism	BEFREE	11543625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohypoparathyroidism, Type Ia	Pseudohypoparathyroidism	BEFREE	15521982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudopseudohypoparathyroidism	Pseudopseudohypoparathyroidism	BEFREE	11543625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	27981357		★★★★★ ★☆☆☆☆ Found in Text Mining only

STK25 (serine/threonine kinase 25)