Gene Gene information from NCBI Gene database.
Entrez ID 10493
Gene name Vesicle amine transport 1
Gene symbol VAT1
Synonyms (NCBI Gene)
VATI
Chromosome 17
Chromosome location 17q21.31
Summary Synaptic vesicles are responsible for regulating the storage and release of neurotransmitters in the nerve terminal. The protein encoded by this gene is an abundant integral membrane protein of cholinergic synaptic vesicles and is thought to be involved i
miRNA miRNA information provided by mirtarbase database.
495
miRTarBase ID miRNA Experiments Reference
MIRT016832 hsa-miR-335-5p Microarray 18185580
MIRT048825 hsa-miR-93-5p CLASH 23622248
MIRT640991 hsa-miR-6892-3p HITS-CLIP 23824327
MIRT640990 hsa-miR-2276-5p HITS-CLIP 23824327
MIRT640989 hsa-miR-4469 HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005576 Component Extracellular region TAS
GO:0005737 Component Cytoplasm IEA
GO:0005739 Component Mitochondrion IEA
GO:0005741 Component Mitochondrial outer membrane IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604631 16919 ENSG00000108828
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q99536
Protein name Synaptic vesicle membrane protein VAT-1 homolog (EC 1.-.-.-)
Protein function Possesses ATPase activity (By similarity). Plays a part in calcium-regulated keratinocyte activation in epidermal repair mechanisms. Has no effect on cell proliferation. Negatively regulates mitochondrial fusion in cooperation with mitofusin pro
PDB 6K9Y , 6LHR , 6LII
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08240 ADH_N 76 144 Alcohol dehydrogenase GroES-like domain Domain
PF13602 ADH_zinc_N_2 232 385 Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in brain. Also expressed in glioblastoma cells. {ECO:0000269|PubMed:19508442}.
Sequence
MSDEREVAEAATGEDASSPPPKTEAASDPQHPAASEGAAAAAASPPLLRCLVLTGFGGYD
KVKLQSRPAAPPAPGPGQLTLRLRACGLNFADLMARQGLYDRLPPLPVTPGMEGAGVVIA
VGEGVSDRKAGDRVMVLNRSGMWQ
EEVTVPSVQTFLIPEAMTFEEAAALLVNYITAYMVL
FDFGNLQPGHSVLVHMAAGGVGMAAVQLCRTVENVTVFGTASASKHEALKENGVTHPIDY
HTTDYVDEIKKISPKGVDIVMDPLGGSDTAKGYNLLKPMGKVVTYGMANLLTGPKRNLMA
LARTWWNQFSVTALQLLQANRAVCGFHLGYLDGEVELVSGVVARLLALYNQGHIKPHIDS
VWPFEKVADAMKQMQEKKNVGKVLL
VPGPEKEN
Sequence length 393
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Neutrophil degranulation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CORONARY ARTERY DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Benign Prostatic Hyperplasia Benign Prostatic Hyperplasia BEFREE 21394740
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 9581869
★☆☆☆☆
Found in Text Mining only
Carcinoma, Ovarian Epithelial Ovarian Epithelial carcinoma BEFREE 30970615
★☆☆☆☆
Found in Text Mining only
Cirrhosis Cirrhosis BEFREE 29023899
★☆☆☆☆
Found in Text Mining only
Coronary Artery Disease Coronary artery disease GWASCAT_DG 29212778
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Epilepsy Generalized Generalized epilepsy Pubtator 40495522 Associate
★☆☆☆☆
Found in Text Mining only
Epithelial ovarian cancer Ovarian cancer BEFREE 30970615
★☆☆☆☆
Found in Text Mining only
Glioblastoma Glioblastoma BEFREE 19508442, 31524269
★☆☆☆☆
Found in Text Mining only
Glioblastoma Multiforme Glioblastoma BEFREE 19508442, 31524269
★☆☆☆☆
Found in Text Mining only
Glioma Glioma BEFREE 19508442
★☆☆☆☆
Found in Text Mining only