Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	10481
Gene name	Homeobox B13
Gene symbol	HOXB13
Synonyms (NCBI Gene)	HPC9PSGD
Chromosome	17
Chromosome location	17q21.32
Summary	This gene encodes a transcription factor that belongs to the homeobox gene family. Genes of this family are highly conserved among vertebrates and essential for vertebrate embryonic development. This gene has been implicated to play a role in fetal skin d

Show/Hide all (2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs77179853	A>-	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Frameshift variant, stop lost, terminator codon variant
rs138213197	C>T	Pathogenic, pathogenic-likely-pathogenic, risk-factor, likely-pathogenic	Coding sequence variant, missense variant

114

Show/Hide all (114)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019730	hsa-miR-375	Microarray	20215506
MIRT490314	hsa-miR-1321	PAR-CLIP	23592263
MIRT490312	hsa-miR-4739	PAR-CLIP	23592263
MIRT490311	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT490310	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT490309	hsa-miR-4671-5p	PAR-CLIP	23592263
MIRT490308	hsa-miR-4285	PAR-CLIP	23592263
MIRT490307	hsa-miR-4419a	PAR-CLIP	23592263
MIRT490306	hsa-miR-4510	PAR-CLIP	23592263
MIRT490305	hsa-miR-6127	PAR-CLIP	23592263
MIRT490304	hsa-miR-6129	PAR-CLIP	23592263
MIRT490303	hsa-miR-6130	PAR-CLIP	23592263
MIRT490302	hsa-miR-6133	PAR-CLIP	23592263
MIRT490301	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT490300	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT490299	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT490298	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT490297	hsa-miR-193b-5p	PAR-CLIP	23592263
MIRT490296	hsa-miR-629-5p	PAR-CLIP	23592263
MIRT490295	hsa-miR-299-5p	PAR-CLIP	23592263
MIRT490314	hsa-miR-1321	PAR-CLIP	23592263
MIRT490312	hsa-miR-4739	PAR-CLIP	23592263
MIRT490311	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT490310	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT490309	hsa-miR-4671-5p	PAR-CLIP	23592263
MIRT490308	hsa-miR-4285	PAR-CLIP	23592263
MIRT490307	hsa-miR-4419a	PAR-CLIP	23592263
MIRT490306	hsa-miR-4510	PAR-CLIP	23592263
MIRT490305	hsa-miR-6127	PAR-CLIP	23592263
MIRT490304	hsa-miR-6129	PAR-CLIP	23592263
MIRT490303	hsa-miR-6130	PAR-CLIP	23592263
MIRT490302	hsa-miR-6133	PAR-CLIP	23592263
MIRT490301	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT490300	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT490299	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT490298	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT490297	hsa-miR-193b-5p	PAR-CLIP	23592263
MIRT490296	hsa-miR-629-5p	PAR-CLIP	23592263
MIRT490295	hsa-miR-299-5p	PAR-CLIP	23592263
MIRT1053286	hsa-miR-105	CLIP-seq
MIRT1053287	hsa-miR-1197	CLIP-seq
MIRT1053288	hsa-miR-1207-5p	CLIP-seq
MIRT1053289	hsa-miR-1343	CLIP-seq
MIRT1053290	hsa-miR-214	CLIP-seq
MIRT1053291	hsa-miR-2355-5p	CLIP-seq
MIRT1053292	hsa-miR-3065-5p	CLIP-seq
MIRT1053293	hsa-miR-3189-3p	CLIP-seq
MIRT1053294	hsa-miR-328	CLIP-seq
MIRT1053295	hsa-miR-3619-5p	CLIP-seq
MIRT1053296	hsa-miR-3663-5p	CLIP-seq
MIRT1053297	hsa-miR-4286	CLIP-seq
MIRT1053298	hsa-miR-4291	CLIP-seq
MIRT1053299	hsa-miR-4436a	CLIP-seq
MIRT1053300	hsa-miR-4733-5p	CLIP-seq
MIRT1053301	hsa-miR-4736	CLIP-seq
MIRT1053302	hsa-miR-4763-3p	CLIP-seq
MIRT1053303	hsa-miR-495	CLIP-seq
MIRT1053304	hsa-miR-657	CLIP-seq
MIRT1053305	hsa-miR-761	CLIP-seq
MIRT1053306	hsa-miR-922	CLIP-seq
MIRT1549630	hsa-miR-4691-5p	CLIP-seq
MIRT1549630	hsa-miR-4691-5p	CLIP-seq
MIRT2012135	hsa-miR-1915	CLIP-seq
MIRT2012136	hsa-miR-3120-5p	CLIP-seq
MIRT2012137	hsa-miR-3150b-3p	CLIP-seq
MIRT2012138	hsa-miR-3667-3p	CLIP-seq
MIRT2012139	hsa-miR-4646-5p	CLIP-seq
MIRT1549630	hsa-miR-4691-5p	CLIP-seq
MIRT2012140	hsa-miR-4726-3p	CLIP-seq
MIRT2012141	hsa-miR-4768-3p	CLIP-seq
MIRT2012142	hsa-miR-4784	CLIP-seq
MIRT2012143	hsa-miR-483-3p	CLIP-seq
MIRT2012144	hsa-miR-665	CLIP-seq
MIRT1053286	hsa-miR-105	CLIP-seq
MIRT2244376	hsa-miR-1207-3p	CLIP-seq
MIRT2244377	hsa-miR-1910	CLIP-seq
MIRT1053292	hsa-miR-3065-5p	CLIP-seq
MIRT2244378	hsa-miR-3661	CLIP-seq
MIRT2244379	hsa-miR-377	CLIP-seq
MIRT2244380	hsa-miR-4251	CLIP-seq
MIRT2244381	hsa-miR-4264	CLIP-seq
MIRT2244382	hsa-miR-4268	CLIP-seq
MIRT1053297	hsa-miR-4286	CLIP-seq
MIRT2244383	hsa-miR-4313	CLIP-seq
MIRT2244384	hsa-miR-4446-5p	CLIP-seq
MIRT2244385	hsa-miR-455-3p	CLIP-seq
MIRT1549630	hsa-miR-4691-5p	CLIP-seq
MIRT2244386	hsa-miR-4755-5p	CLIP-seq
MIRT1053303	hsa-miR-495	CLIP-seq
MIRT2244387	hsa-miR-5096	CLIP-seq
MIRT2244388	hsa-miR-539	CLIP-seq
MIRT2244389	hsa-miR-579	CLIP-seq
MIRT2244390	hsa-miR-631	CLIP-seq
MIRT2244391	hsa-miR-642a	CLIP-seq
MIRT2244392	hsa-miR-661	CLIP-seq
MIRT2244393	hsa-miR-767-5p	CLIP-seq
MIRT2244394	hsa-miR-9	CLIP-seq
MIRT2389122	hsa-miR-137	CLIP-seq
MIRT2389123	hsa-miR-1468	CLIP-seq
MIRT2389124	hsa-miR-1827	CLIP-seq
MIRT2389125	hsa-miR-3064-3p	CLIP-seq
MIRT2389126	hsa-miR-4252	CLIP-seq
MIRT1549630	hsa-miR-4691-5p	CLIP-seq
MIRT2389127	hsa-miR-4715-3p	CLIP-seq
MIRT2389128	hsa-miR-574-5p	CLIP-seq
MIRT2389129	hsa-miR-759	CLIP-seq
MIRT2451331	hsa-miR-122	CLIP-seq
MIRT2451332	hsa-miR-1292	CLIP-seq
MIRT2451333	hsa-miR-3122	CLIP-seq
MIRT2451334	hsa-miR-3165	CLIP-seq
MIRT2451335	hsa-miR-3913-5p	CLIP-seq
MIRT2451336	hsa-miR-4456	CLIP-seq
MIRT2451337	hsa-miR-4471	CLIP-seq
MIRT2244394	hsa-miR-9	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
EZH2	Repression	22808286
HDAC4	Repression	19013255
YY1	Repression	19013255

Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	15126340
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	15126340
GO:0001525	Process	Angiogenesis	IEP	17972163
GO:0002009	Process	Morphogenesis of an epithelium	IEA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008327	Function	Methyl-CpG binding	IDA	28473536
GO:0008544	Process	Epidermis development	TAS	9665387
GO:0009611	Process	Response to wounding	TAS	9665387
GO:0030850	Process	Prostate gland development	IEA
GO:0033574	Process	Response to testosterone	IEA
GO:0040008	Process	Regulation of growth	IEA
GO:0043565	Function	Sequence-specific DNA binding	IDA	23332764
GO:0060527	Process	Prostate epithelial cord arborization involved in prostate glandular acinus morphogenesis	IEA
GO:0060743	Process	Epithelial cell maturation involved in prostate gland development	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
604607	5112	ENSG00000159184

Q92826

Protein name

Homeobox protein Hox-B13

Protein function

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Binds preferentially to methylated DNA (PubMed:28473536). {ECO:0000

PDB

2CRA , 5EDN , 5EEA , 5EF6 , 5EG0 , 5EGO , 5NO6 , 7PSX , 8BYX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12284	HoxA13_N	12 → 123	Hox protein A13 N terminal	Family
PF00046	Homeodomain	217 → 273	Homeodomain	Domain

Sequence

MEPGNYATLDGAKDIEGLLGAGGGRNLVAHSPLTSHPAAPTLMPAVNYAPLDLPGSAEPP
KQCHPCPGVPQGTSPAPVPYGYFGGGYYSCRVSRSSLKPCAQAATLAAYPAETPTAGEEY
PSRPTEFAFYPGYPGTYQPMASYLDVSVVQTLGAPGEPRHDSLLPVDSYQSWALAGGWNS
QMCCQGEQNPPGPFWKAAFADSSGQHPPDACAFRRGRKKRIPYSKGQLRELEREYAANKF
ITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAKVKNSATP

Sequence length

284

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (9)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Breast and/or ovarian cancer	Likely pathogenic; Pathogenic	rs138213197	RCV003492500	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Carcinoma of pancreas	Likely pathogenic; Pathogenic	rs138213197	RCV001391199	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Familial prostate cancer	Likely pathogenic; Pathogenic	rs138213197	RCV001582580	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Gastric cancer	Pathogenic	rs2509512772	RCV003164703	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hereditary cancer-predisposing syndrome	Likely pathogenic; Pathogenic	rs138213197	RCV000561749	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
HOXB13-Related Cancer Predisposition	Likely pathogenic; Pathogenic	rs138213197	RCV003335105	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
HOXB13-related disorder	Likely pathogenic; Pathogenic	rs138213197	RCV004549575	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Prostate cancer susceptibility	Likely pathogenic; Pathogenic	rs138213197	RCV000210093	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Prostate cancer, hereditary, 9	Likely pathogenic; Pathogenic	rs138213197	RCV000714291	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (26)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BILIARY TRACT CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOCELLULAR CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-HODGKINS LYMPHOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance; Conflicting classifications of pathogenicity; Likely benign	ClinVar GWAS catalog GWAS catalog	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
PROSTATE CANCER, FAMILIAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer, hereditary, 1	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (108)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31037158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	28484843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	31128548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	25785959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	26108461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15193263, 17308270, 17453342, 18499701, 18794098, 20649975, 21999244, 23099437, 23497539, 23832664, 24264313, 26728744, 27424772, 29471853		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	24239177		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	15193263	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	18499701, 19250546, 21559019, 21574054, 22293681, 23099437, 23497539, 23812955, 25640367, 26728744, 27424772	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	19793339, 25743797, 26108461, 32376288	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	26176944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	32830201	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25031711	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	26108461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33619226, 39331921	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	17942676		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	25743797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	25743797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	20454457, 31815008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15928669, 20454457, 23292082, 23541221, 26517352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15928669	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	20454457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23541221, 30541551, 33099213, 36356413, 37434131	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms Hereditary Nonpolyposis	Lynch syndrome	Pubtator	36356413	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital thrombotic disease due to Protein C deficiency	Congenital thrombotic thrombocytopenic purpura	Pubtator	31273254	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16278676, 31815008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	12761847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	27018308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	15756448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	25785959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	27956498, 30082829, 33693959, 39596630	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	29236593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial prostate cancer	Prostate Cancer	Orphanet			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Glioblastoma	Glioblastoma	BEFREE	31062400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31062400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30105866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	18499701, 27899188	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary Breast And Ovarian Cancer Syndrome	BEFREE	27899188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	27899188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Pancreatitis	Pubtator	33423702	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	35557042	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	33619226	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	28808656		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	26108461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	26108461, 33099213	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26590121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	18499701, 30541551, 35296171	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	34609407	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15193263, 17308270, 17453342, 18499701, 18794098, 20649975, 21999244, 23099437, 23497539, 23832664, 24264313, 26728744, 27424772, 29471853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	24239177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	27018308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	17942676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15583692, 15604291, 19013255, 20504375, 22236224, 22714738, 22718278, 22781434, 22808286, 22841674, 22974436, 23036981, 23064873, 23099437, 23104005 View all (40 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	UNIPROT_DG	22236224, 22714738, 23064873, 23292082, 25629170, 27424772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	23104005, 24239177, 24390282, 26457646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29928325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	26108461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21574054, 23541221, 24325868, 25629170, 26108461, 26517352, 27018308, 29181843, 29928325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	25743797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	20454457, 31815008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	24239177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16609001, 16609019, 17008703, 17453342, 17975144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	24239177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	27424772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	24239177		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	17145863		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	LHGDN	17145863		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	CTD_human_DG	17145863		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	26590121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myxopapillary ependymoma	Myxopapillary Ependymoma	BEFREE	19793339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16278676, 17008703, 17308270, 17942676, 18451222, 18499701, 18794098, 20454457, 20504375, 20649975, 20945089, 21574054, 21999244, 23832664, 25631336 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplastic Syndromes, Hereditary	Hereditary Cancer Syndrome	CLINVAR_DG	15964834, 17138648, 22236224, 22714738, 22781434, 22841674, 22853031, 23064873, 23292082, 23393222, 23457453, 23518396, 23541221, 24026887, 24310616 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	16609019, 17942676, 23832664, 25640367, 29471853		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	17942676		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	17942676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25944620, 35639251	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	26261579	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	Pubtator	25743797	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Phyllodes Tumor	Phyllodes Tumor	BEFREE	20945089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate cancer familial	Prostate cancer	Pubtator	22236224, 22714738, 22948022, 23396964, 23457453, 24722062, 25595936, 27899188, 28272408, 28790484, 31556563, 34059701	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate cancer, familial	Prostate cancer	BEFREE	22236224, 22714738, 22841674, 23396964, 24026887, 24722062, 25595936, 27819754, 27899188, 28072499, 28272408		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer, familial	Prostate cancer	CTD_human_DG	22236224		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer, familial	Prostate cancer	ORPHANET_DG	22236224		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER, HEREDITARY, 1	Prostate Cancer, Hereditary	CTD_human_DG	22236224		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate Cancer, Hereditary, 9	Prostate Cancer, Hereditary	CLINVAR_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Prostate Cancer, Hereditary, 9	Prostate Cancer, Hereditary	CTD_human_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Prostate carcinoma	Prostate cancer	BEFREE	15583692, 15604291, 20504375, 22236224, 22714738, 22718278, 22781434, 22808286, 22841674, 22974436, 23036981, 23064873, 23099437, 23104005, 23129385 View all (38 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	GWASCAT_DG	29892016		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	26554830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15126340, 15604291		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15583692, 17280610, 19917249, 20504375, 22236224, 22293681, 22714738, 22718278, 22808286, 23036981, 23064873, 23099437, 23104005, 23129385, 23318356 View all (67 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	23104005, 24239177, 24390282, 26457646		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	26457646, 28186998, 29259341, 29844167, 31273254, 31735626		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16278676, 31815008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid tumor	Pubtator	32376288	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	32830201	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	27956498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28808656, 33315534, 37245006	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29928325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	34864309	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	33099213, 34396425, 34864309	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	24189220	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24189220, 26108461	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	26590121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	16445654, 16803519, 25743797, 28402266, 33099213	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

HOXB13 (homeobox B13)