Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10480
Gene name	Eukaryotic translation initiation factor 3 subunit M
Gene symbol	EIF3M
Synonyms (NCBI Gene)	B5GA17PCID1TANGO7hfl-B5
Chromosome	11
Chromosome location	11p13
Summary	This gene encodes a protein that is part of the eurkaryotic translation initiation factor 3 complete (eIF-3) required for protein synthesis. Elevated levels of the encoded protein are present in cancer cell lines. Inactivation of the encoded protein has b

Show/Hide all (13)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022389	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT031556	hsa-miR-16-5p	Proteomics	18668040
MIRT048348	hsa-miR-106a-5p	CLASH	23622248
MIRT043004	hsa-miR-324-3p	CLASH	23622248
MIRT041230	hsa-miR-193b-3p	CLASH	23622248
MIRT040019	hsa-miR-615-3p	CLASH	23622248
MIRT037709	hsa-miR-744-5p	CLASH	23622248
MIRT496163	hsa-miR-3671	PAR-CLIP	22291592
MIRT494915	hsa-miR-3662	PAR-CLIP	23708386
MIRT494914	hsa-miR-549a	PAR-CLIP	23708386
MIRT496163	hsa-miR-3671	PAR-CLIP	22291592
MIRT494915	hsa-miR-3662	PAR-CLIP	23708386
MIRT494914	hsa-miR-549a	PAR-CLIP	23708386

Show/Hide all (1)

Transcription factor	Regulation	Reference
ZIC1	Activation	20713527

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001732	Process	Formation of cytoplasmic translation initiation complex	IEA
GO:0001732	Process	Formation of cytoplasmic translation initiation complex	NAS	16920360
GO:0002183	Process	Cytoplasmic translational initiation	IBA
GO:0002183	Process	Cytoplasmic translational initiation	IEA
GO:0003743	Function	Translation initiation factor activity	IC	17322308, 18599441
GO:0003743	Function	Translation initiation factor activity	IDA	25849773
GO:0003743	Function	Translation initiation factor activity	IEA
GO:0005515	Function	Protein binding	IPI	16169070, 18599441, 19615732, 19748344, 22190034, 23623729, 25416956, 28514442, 32296183, 33961781, 35271311
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IBA
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IDA	17322308, 18599441, 25849773
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IEA
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IPI	17322308
GO:0006412	Process	Translation	IEA
GO:0006412	Process	Translation	IEA
GO:0006413	Process	Translational initiation	IC	17322308, 18599441
GO:0006413	Process	Translational initiation	IEA
GO:0016282	Component	Eukaryotic 43S preinitiation complex	IEA
GO:0031369	Function	Translation initiation factor binding	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0033290	Component	Eukaryotic 48S preinitiation complex	IEA
GO:0071541	Component	Eukaryotic translation initiation factor 3 complex, eIF3m	IEA

MIM	HGNC	e!Ensembl
609641	24460	ENSG00000149100

Q7L2H7

Protein name

Eukaryotic translation initiation factor 3 subunit M (eIF3m) (Fetal lung protein B5) (hFL-B5) (PCI domain-containing protein 1)

Protein function

Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis (PubMed:17403899, PubMed:25849773, PubMed:27462815). The eIF-3 complex associates with the 40

PDB

3J8B , 3J8C , 6FEC , 6YBD , 6ZMW , 6ZON , 6ZP4 , 6ZVJ , 7A09 , 7QP6 , 7QP7 , 8OZ0 , 8PJ1 , 8PJ2 , 8PJ3 , 8PJ4 , 8PJ5 , 8PJ6 , 8PPL , 8RG0 , 8XXN , 9BLN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01399	PCI	235 → 336	PCI domain	Domain
PF18005	eIF3m_C_helix	340 → 368	eIF3 subunit M, C-terminal helix	Domain

Tissue specificity

TISSUE SPECIFICITY: Broadly expressed. {ECO:0000269|PubMed:15919898}.

Sequence

MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDV
ESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVR
YTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDA
ASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDL
LTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQE
LQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQN
LNKVKNSLLSLSDT

Sequence length

374

Interactions

View interactions

	Reactome
			L13a-mediated translational silencing of Ceruloplasmin expression Translation initiation complex formation Formation of a pool of free 40S subunits Formation of the ternary complex, and subsequently, the 43S complex Ribosomal scanning and start codon recognition GTP hydrolysis and joining of the 60S ribosomal subunit

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (11)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Colon Carcinoma	Colon Carcinoma	BEFREE	20838379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	20962418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	29532746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	1370880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	1370880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	32664164	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20838379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	20838379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31171919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	32664164	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

EIF3M (eukaryotic translation initiation factor 3 subunit M)