CEACAM5 (CEA cell adhesion molecule 5)

Gene

• Entrez ID: 1048
• Gene name: CEA cell adhesion molecule 5
• Gene symbol: CEACAM5
• Synonyms (NCBI Gene): CD66e, CEA
• Chromosome: 19
• Chromosome location: 19q13.2
• Summary: This gene encodes a cell surface glycoprotein that represents the founding member of the carcinoembryonic antigen (CEA) family of proteins. The encoded protein is used as a clinical biomarker for gastrointestinal cancers and may promote tumor development

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018234	hsa-miR-335-5p	Microarray	18185580
MIRT677795	hsa-miR-582-3p	HITS-CLIP	23824327
MIRT677794	hsa-miR-552-3p	HITS-CLIP	23824327
MIRT677793	hsa-miR-764	HITS-CLIP	23824327
MIRT677792	hsa-miR-4740-3p	HITS-CLIP	23824327
MIRT677791	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT677790	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT677789	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT677788	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT677787	hsa-miR-1976	HITS-CLIP	23824327
MIRT677786	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT677785	hsa-miR-4783-5p	HITS-CLIP	23824327
MIRT677784	hsa-miR-3199	HITS-CLIP	23824327
MIRT677783	hsa-miR-8052	HITS-CLIP	23824327
MIRT677782	hsa-miR-365a-5p	HITS-CLIP	23824327
MIRT677781	hsa-miR-365b-5p	HITS-CLIP	23824327
MIRT677780	hsa-miR-4279	HITS-CLIP	23824327
MIRT677795	hsa-miR-582-3p	HITS-CLIP	23824327
MIRT677794	hsa-miR-552-3p	HITS-CLIP	23824327
MIRT677793	hsa-miR-764	HITS-CLIP	23824327
MIRT677792	hsa-miR-4740-3p	HITS-CLIP	23824327
MIRT677791	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT677790	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT677789	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT677788	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT677787	hsa-miR-1976	HITS-CLIP	23824327
MIRT677786	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT677785	hsa-miR-4783-5p	HITS-CLIP	23824327
MIRT677784	hsa-miR-3199	HITS-CLIP	23824327
MIRT677783	hsa-miR-8052	HITS-CLIP	23824327
MIRT677782	hsa-miR-365a-5p	HITS-CLIP	23824327
MIRT677781	hsa-miR-365b-5p	HITS-CLIP	23824327
MIRT677780	hsa-miR-4279	HITS-CLIP	23824327
MIRT882994	hsa-miR-1193	CLIP-seq
MIRT882995	hsa-miR-1208	CLIP-seq
MIRT882996	hsa-miR-122	CLIP-seq
MIRT882997	hsa-miR-1264	CLIP-seq
MIRT882998	hsa-miR-129-5p	CLIP-seq
MIRT882999	hsa-miR-134	CLIP-seq
MIRT883000	hsa-miR-150	CLIP-seq
MIRT883001	hsa-miR-1915	CLIP-seq
MIRT883002	hsa-miR-223	CLIP-seq
MIRT883003	hsa-miR-2392	CLIP-seq
MIRT883004	hsa-miR-3118	CLIP-seq
MIRT883005	hsa-miR-3135b	CLIP-seq
MIRT883006	hsa-miR-3136-5p	CLIP-seq
MIRT883007	hsa-miR-3152-3p	CLIP-seq
MIRT883008	hsa-miR-3652	CLIP-seq
MIRT883009	hsa-miR-376c	CLIP-seq
MIRT883010	hsa-miR-3944-5p	CLIP-seq
MIRT883011	hsa-miR-3973	CLIP-seq
MIRT883012	hsa-miR-410	CLIP-seq
MIRT883013	hsa-miR-4294	CLIP-seq
MIRT883014	hsa-miR-4304	CLIP-seq
MIRT883015	hsa-miR-4420	CLIP-seq
MIRT883016	hsa-miR-4430	CLIP-seq
MIRT883017	hsa-miR-4438	CLIP-seq
MIRT883018	hsa-miR-4439	CLIP-seq
MIRT883019	hsa-miR-4454	CLIP-seq
MIRT883020	hsa-miR-4513	CLIP-seq
MIRT883021	hsa-miR-4527	CLIP-seq
MIRT883022	hsa-miR-4662a-5p	CLIP-seq
MIRT883023	hsa-miR-4676-5p	CLIP-seq
MIRT883024	hsa-miR-4697-3p	CLIP-seq
MIRT883025	hsa-miR-4707-3p	CLIP-seq
MIRT883026	hsa-miR-4713-5p	CLIP-seq
MIRT883027	hsa-miR-4726-3p	CLIP-seq
MIRT883028	hsa-miR-4782-5p	CLIP-seq
MIRT883029	hsa-miR-5095	CLIP-seq
MIRT883030	hsa-miR-520g	CLIP-seq
MIRT883031	hsa-miR-520h	CLIP-seq
MIRT883032	hsa-miR-532-3p	CLIP-seq
MIRT883033	hsa-miR-548p	CLIP-seq
MIRT883034	hsa-miR-554	CLIP-seq
MIRT883035	hsa-miR-575	CLIP-seq
MIRT883036	hsa-miR-622	CLIP-seq
MIRT883037	hsa-miR-892a	CLIP-seq
MIRT1961787	hsa-miR-106a	CLIP-seq
MIRT1961788	hsa-miR-106b	CLIP-seq
MIRT1961789	hsa-miR-1206	CLIP-seq
MIRT882996	hsa-miR-122	CLIP-seq
MIRT1961790	hsa-miR-1287	CLIP-seq
MIRT1961791	hsa-miR-1324	CLIP-seq
MIRT1961792	hsa-miR-148a	CLIP-seq
MIRT1961793	hsa-miR-148b	CLIP-seq
MIRT883000	hsa-miR-150	CLIP-seq
MIRT1961794	hsa-miR-152	CLIP-seq
MIRT1961795	hsa-miR-17	CLIP-seq
MIRT883001	hsa-miR-1915	CLIP-seq
MIRT1961796	hsa-miR-20a	CLIP-seq
MIRT1961797	hsa-miR-20b	CLIP-seq
MIRT1961798	hsa-miR-302a	CLIP-seq
MIRT1961799	hsa-miR-302b	CLIP-seq
MIRT1961800	hsa-miR-302c	CLIP-seq
MIRT1961801	hsa-miR-302d	CLIP-seq
MIRT1961802	hsa-miR-302e	CLIP-seq
MIRT883005	hsa-miR-3135b	CLIP-seq
MIRT1961803	hsa-miR-361-5p	CLIP-seq
MIRT883008	hsa-miR-3652	CLIP-seq
MIRT1961804	hsa-miR-372	CLIP-seq
MIRT1961805	hsa-miR-373	CLIP-seq
MIRT883010	hsa-miR-3944-5p	CLIP-seq
MIRT883011	hsa-miR-3973	CLIP-seq
MIRT883013	hsa-miR-4294	CLIP-seq
MIRT883014	hsa-miR-4304	CLIP-seq
MIRT883016	hsa-miR-4430	CLIP-seq
MIRT883017	hsa-miR-4438	CLIP-seq
MIRT1961806	hsa-miR-4494	CLIP-seq
MIRT1961807	hsa-miR-4532	CLIP-seq
MIRT883026	hsa-miR-4713-5p	CLIP-seq
MIRT883027	hsa-miR-4726-3p	CLIP-seq
MIRT1961808	hsa-miR-4731-5p	CLIP-seq
MIRT1961809	hsa-miR-4757-5p	CLIP-seq
MIRT1961810	hsa-miR-498	CLIP-seq
MIRT1961811	hsa-miR-499a-5p	CLIP-seq
MIRT883029	hsa-miR-5095	CLIP-seq
MIRT1961812	hsa-miR-512-3p	CLIP-seq
MIRT1961813	hsa-miR-519d	CLIP-seq
MIRT1961814	hsa-miR-520a-3p	CLIP-seq
MIRT1961815	hsa-miR-520b	CLIP-seq
MIRT1961816	hsa-miR-520c-3p	CLIP-seq
MIRT1961817	hsa-miR-520d-3p	CLIP-seq
MIRT1961818	hsa-miR-520e	CLIP-seq
MIRT883030	hsa-miR-520g	CLIP-seq
MIRT883031	hsa-miR-520h	CLIP-seq
MIRT883032	hsa-miR-532-3p	CLIP-seq
MIRT1961819	hsa-miR-561	CLIP-seq
MIRT1961820	hsa-miR-630	CLIP-seq
MIRT1961821	hsa-miR-643	CLIP-seq
MIRT1961822	hsa-miR-93	CLIP-seq
MIRT2198340	hsa-miR-1200	CLIP-seq
MIRT2198341	hsa-miR-1202	CLIP-seq
MIRT1961789	hsa-miR-1206	CLIP-seq
MIRT882996	hsa-miR-122	CLIP-seq
MIRT883000	hsa-miR-150	CLIP-seq
MIRT2198342	hsa-miR-186	CLIP-seq
MIRT883001	hsa-miR-1915	CLIP-seq
MIRT2198343	hsa-miR-203	CLIP-seq
MIRT2198344	hsa-miR-2276	CLIP-seq
MIRT2198345	hsa-miR-24	CLIP-seq
MIRT2198346	hsa-miR-3133	CLIP-seq
MIRT883005	hsa-miR-3135b	CLIP-seq
MIRT2198347	hsa-miR-3140-5p	CLIP-seq
MIRT2198348	hsa-miR-3173-5p	CLIP-seq
MIRT2198349	hsa-miR-3185	CLIP-seq
MIRT2198350	hsa-miR-362-5p	CLIP-seq
MIRT2198351	hsa-miR-3646	CLIP-seq
MIRT883008	hsa-miR-3652	CLIP-seq
MIRT883010	hsa-miR-3944-5p	CLIP-seq
MIRT2198352	hsa-miR-3972	CLIP-seq
MIRT2198353	hsa-miR-4284	CLIP-seq
MIRT883014	hsa-miR-4304	CLIP-seq
MIRT2198354	hsa-miR-4324	CLIP-seq
MIRT2198355	hsa-miR-4423-5p	CLIP-seq
MIRT883016	hsa-miR-4430	CLIP-seq
MIRT2198356	hsa-miR-4463	CLIP-seq
MIRT2198357	hsa-miR-4466	CLIP-seq
MIRT1961806	hsa-miR-4494	CLIP-seq
MIRT1961807	hsa-miR-4532	CLIP-seq
MIRT883026	hsa-miR-4713-5p	CLIP-seq
MIRT883027	hsa-miR-4726-3p	CLIP-seq
MIRT2198358	hsa-miR-4733-3p	CLIP-seq
MIRT1961810	hsa-miR-498	CLIP-seq
MIRT2198359	hsa-miR-500b	CLIP-seq
MIRT2198360	hsa-miR-501-5p	CLIP-seq
MIRT883032	hsa-miR-532-3p	CLIP-seq
MIRT2198361	hsa-miR-544b	CLIP-seq
MIRT2198362	hsa-miR-675	CLIP-seq
MIRT883003	hsa-miR-2392	CLIP-seq
MIRT2385904	hsa-miR-3674	CLIP-seq
MIRT883017	hsa-miR-4438	CLIP-seq
MIRT1961806	hsa-miR-4494	CLIP-seq
MIRT1961811	hsa-miR-499a-5p	CLIP-seq
MIRT883029	hsa-miR-5095	CLIP-seq
MIRT2198341	hsa-miR-1202	CLIP-seq
MIRT882996	hsa-miR-122	CLIP-seq
MIRT2446794	hsa-miR-1267	CLIP-seq
MIRT2446795	hsa-miR-1289	CLIP-seq
MIRT2446796	hsa-miR-3194-3p	CLIP-seq
MIRT2446797	hsa-miR-3198	CLIP-seq
MIRT2198352	hsa-miR-3972	CLIP-seq
MIRT883013	hsa-miR-4294	CLIP-seq
MIRT2446798	hsa-miR-4309	CLIP-seq
MIRT2446799	hsa-miR-431	CLIP-seq
MIRT2198355	hsa-miR-4423-5p	CLIP-seq
MIRT2198356	hsa-miR-4463	CLIP-seq
MIRT1961806	hsa-miR-4494	CLIP-seq
MIRT1961807	hsa-miR-4532	CLIP-seq
MIRT2446800	hsa-miR-4534	CLIP-seq
MIRT1961810	hsa-miR-498	CLIP-seq
MIRT2446801	hsa-miR-924	CLIP-seq
MIRT1961807	hsa-miR-4532	CLIP-seq
MIRT1961810	hsa-miR-498	CLIP-seq
MIRT2198341	hsa-miR-1202	CLIP-seq
MIRT882996	hsa-miR-122	CLIP-seq
MIRT882998	hsa-miR-129-5p	CLIP-seq
MIRT883000	hsa-miR-150	CLIP-seq
MIRT883001	hsa-miR-1915	CLIP-seq
MIRT883005	hsa-miR-3135b	CLIP-seq
MIRT2501463	hsa-miR-3149	CLIP-seq
MIRT883008	hsa-miR-3652	CLIP-seq
MIRT883010	hsa-miR-3944-5p	CLIP-seq
MIRT2198352	hsa-miR-3972	CLIP-seq
MIRT883014	hsa-miR-4304	CLIP-seq
MIRT2198355	hsa-miR-4423-5p	CLIP-seq
MIRT883016	hsa-miR-4430	CLIP-seq
MIRT2198356	hsa-miR-4463	CLIP-seq
MIRT2198357	hsa-miR-4466	CLIP-seq
MIRT1961806	hsa-miR-4494	CLIP-seq
MIRT1961807	hsa-miR-4532	CLIP-seq
MIRT883026	hsa-miR-4713-5p	CLIP-seq
MIRT883027	hsa-miR-4726-3p	CLIP-seq
MIRT1961810	hsa-miR-498	CLIP-seq
MIRT883032	hsa-miR-532-3p	CLIP-seq
MIRT2198362	hsa-miR-675	CLIP-seq
MIRT882996	hsa-miR-122	CLIP-seq
MIRT882998	hsa-miR-129-5p	CLIP-seq
MIRT883000	hsa-miR-150	CLIP-seq
MIRT883001	hsa-miR-1915	CLIP-seq
MIRT883005	hsa-miR-3135b	CLIP-seq
MIRT2501463	hsa-miR-3149	CLIP-seq
MIRT883008	hsa-miR-3652	CLIP-seq
MIRT883010	hsa-miR-3944-5p	CLIP-seq
MIRT883014	hsa-miR-4304	CLIP-seq
MIRT883016	hsa-miR-4430	CLIP-seq
MIRT1961807	hsa-miR-4532	CLIP-seq
MIRT883026	hsa-miR-4713-5p	CLIP-seq
MIRT883027	hsa-miR-4726-3p	CLIP-seq
MIRT1961810	hsa-miR-498	CLIP-seq
MIRT883032	hsa-miR-532-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
USF1	Activation	7876096
USF2	Activation	7876096

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	27489282
GO:0005576	Component	Extracellular region	TAS
GO:0005886	Component	Plasma membrane	IDA	10864933, 10931872
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	3814146
GO:0006915	Process	Apoptotic process	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IMP	2803308
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IBA
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IMP	2803308
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IC	2803308
GO:0009986	Component	Cell surface	IDA	2317824
GO:0009986	Component	Cell surface	IEA
GO:0010832	Process	Negative regulation of myotube differentiation	IDA	8408226, 10931872
GO:0016020	Component	Membrane	IDA	2317824
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IDA	15052268
GO:0016324	Component	Apical plasma membrane	IDA	10436421
GO:0016324	Component	Apical plasma membrane	IEA
GO:0034109	Process	Homotypic cell-cell adhesion	IDA	10864933
GO:0034235	Function	GPI anchor binding	IMP	10931872
GO:0042802	Function	Identical protein binding	IDA	26483485
GO:0042802	Function	Identical protein binding	IPI	10864933, 18086185, 26483485
GO:0042803	Function	Protein homodimerization activity	IDA	18086185
GO:0043066	Process	Negative regulation of apoptotic process	IDA	11448920
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0098552	Component	Side of membrane	IEA
GO:2000811	Process	Negative regulation of anoikis	IDA	10910050

Other IDs

• MIM: 114890
• HGNC: 1817
• e!Ensembl: ENSG00000105388

Protein

• UniProt ID: P06731
• Protein name: Cell adhesion molecule CEACAM5 (Carcinoembryonic antigen) (CEA) (Carcinoembryonic antigen-related cell adhesion molecule 5) (CEA cell adhesion molecule 5) (Meconium antigen 100) (CD antigen CD66e)
• Protein function: Cell surface glycoprotein that plays a role in cell adhesion, intracellular signaling and tumor progression (PubMed:10864933, PubMed:10910050, PubMed:2803308). Mediates homophilic and heterophilic cell adhesion with other carcinoembryonic antige
• PDB: 1E07, 2QSQ, 2QST, 2VER, 8BW0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07686	V-set	38 → 141	Immunoglobulin V-set domain	Domain
  PF13927	Ig_3	146 → 219		Domain
  PF13895	Ig_2	239 → 318	Immunoglobulin domain	Domain
  PF13927	Ig_3	324 → 397		Domain
  PF13895	Ig_2	417 → 496	Immunoglobulin domain	Domain
  PF13927	Ig_3	502 → 575		Domain
  PF13895	Ig_2	595 → 674	Immunoglobulin domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in columnar epithelial and goblet cells of the colon (at protein level) (PubMed:10436421). Found in adenocarcinomas of endodermally derived digestive system epithelium and fetal colon. {ECO:0000269|PubMed:10436421}.
• Sequence:

  MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQ
  HLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFY
  TLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWV
  NNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAP
  TISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQ
  AHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNN
  QSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNKLSVDHSDPVILNVLYGPDDPTI
  SPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQAN
  NSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQS
  LPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISP
  PDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNL
  ATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI

• Sequence length: 702

Pathways

Reactome:

Post-translational modification: synthesis of GPI-anchored proteins
Cell surface interactions at the vascular wall

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTROCYTOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Cerebrovascular Accidents	Stroke	BEFREE	31603298		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	31295447, 7808000		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	2789512		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	10873071, 11058588, 11092617, 11263866, 12460911, 14760382, 1484322, 15154633, 15316325, 16536871, 17540439, 17941001, 19118044, 21397974, 22252332, 24388361, 24487967, 24852187, 27072585, 28295553, 2830274, 28744138, 28748318, 28877268, 28950357, 29069854, 2912558, 29211356, 29765230, 29848682, 29997989, 30115364, 30233867, 30250539, 30458812, 30745297, 30849967, 3133333, 31568496, 31585122, 6236377, 6821838, 7600027, 7690349, 8317550, 8950323, 9135022, 9914791		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	15546874, 17941001		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	10081486, 11790722, 1860736, 26053394, 26975699, 28005644, 29895542, 3670312, 61812, 6871845		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	30724779		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	11706527, 14592671, 28596788, 7501974		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	10022223, 17941001, 19679554, 22483782, 23099808, 23621221, 24190459, 24459065, 24487967, 24935562, 27990560, 28642881, 28705152, 28744138, 28950357, 29069748, 29211356, 29233112, 29550204, 29849818, 29874986, 29997989, 30178907, 30329165, 30379408, 30637712, 30647803, 30944644, 31312384, 7923150		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	25409014, 30153903		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	29686080		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of rectum	Adenocarcinoma Of Rectum	BEFREE	30108119, 30822523		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	11706527, 1202622, 12460911, 15855928, 2067130, 2125040, 27100181, 28792134, 3544799, 61812		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	2125040, 28792134, 3544799		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	11731437, 15150127, 17211733, 18937552		★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	19147569		★☆☆☆☆ Found in Text Mining only
Anal carcinoma	Anal Cancer	BEFREE	31319725		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	23158209, 8826938		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	12460911, 30578740, 30931812		★☆☆☆☆ Found in Text Mining only
Anhidrosis	Anhidrosis	BEFREE	28662305		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	25409014, 28280354, 28915633, 29171983		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	28933920		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	28933920, 31430856, 35550122	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	12460911, 14679013, 15150127, 21671129, 24327292		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	8385475		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	15855928, 31590408		★☆☆☆☆ Found in Text Mining only
Bile duct carcinoma	Bile duct carcinoma	BEFREE	10414697		★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	28111425, 28375170		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	30579185		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	9185702		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	7512130		★☆☆☆☆ Found in Text Mining only
Breast cancer, lobular	Breast Cancer	BEFREE	22983919		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10516681, 10564638, 10592099, 10961688, 11553856, 11592097, 12820473, 14534701, 15508191, 16203775, 16254457, 16289546, 16642271, 19787229, 20586026, 21594664, 22274803, 22692639, 22782345, 23389917, 23525470, 25832000, 25976781, 26892612, 27909883, 28112857, 28203552, 28228086, 28869448, 28969044, 29433529, 29611386, 29701836, 29854028, 29854296, 29936704, 30029406, 30214602, 30535933, 30666318, 30825229, 30843272, 31247453, 31285868, 31312932, 31364001, 31412345, 31653144, 31742206, 7541767, 7914825, 9544822		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30924846, 31839604	Associate	★☆☆☆☆ Found in Text Mining only
Cancer of Urinary Tract	Urinary Tract Cancer	BEFREE	10810356		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20187983, 24618292, 31171910	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22195770	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10202129, 10656428, 10815889, 10873083, 10962448, 11129322, 11289125, 11731437, 11896570, 1202622, 12374692, 12719706, 14592671, 15580629, 15613691, 16254038, 16332726, 17413979, 1771385, 1860736, 18812201, 18937552, 19686851, 19811429, 20386466, 2067130, 2125040, 21633954, 22595052, 27581603, 28122068, 28314278, 31028099, 31564877, 3235849, 3816909, 7512130, 7688074, 824719, 8386136, 8898638, 8950323, 9973217		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	31171910	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32212818	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of uterine cervix	Cervical Intraepithelial Neoplasia	BEFREE	29285261		★☆☆☆☆ Found in Text Mining only
Carcinoma of ampulla of Vater	Ampullary Carcinoma	BEFREE	28367245, 28875420		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	9185702		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	1330929, 15623614, 18823584, 2067130, 22099873, 22129186, 22274803, 24072496, 25425729, 25961003, 26260621, 26605871, 26782458, 27080225, 27988480, 28110687, 28117344, 28152979, 28229299, 28411630, 28487728, 28514755, 28586008, 28607926, 28744310, 28940455, 29094803, 29247745, 29412152, 29435038, 29528442, 29731641, 29780629, 29970696, 30032839, 30245753, 30672447, 30903516, 30905451, 31072477, 31128008, 31319980, 31374012, 31410309, 31548657, 31568496, 31646071, 7638808, 7678982, 7923150		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	24476519, 31731384, 33004930, 36656512, 40379788	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	29596894		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	14578465, 16551872, 28228086, 31399054, 31590408		★☆☆☆☆ Found in Text Mining only
Carcinomatosis of peritoneal cavity	Peritoneal Carcinomatosis	BEFREE	16427547, 28138878, 29097747, 29266235, 29543051, 31050365, 31802190		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	26911181		★☆☆☆☆ Found in Text Mining only
CATARACT, MARNER TYPE	Cataract	BEFREE	16203775		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	28505148, 30341824, 30418006, 30827085, 30922980, 31603297, 31626932		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	9570998		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	27984373, 9570998		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	11023196, 27358229, 28373474, 29208940, 29438681, 30022384, 30863466, 31410063, 8957064		★☆☆☆☆ Found in Text Mining only
Choroid Plexus Carcinoma	Choroid Plexus Carcinoma	BEFREE	28138878		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28561881		★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	31821607		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	31184445		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	6673057		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	21157437, 24686242		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	34394073	Stimulate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10399951, 10778949, 10789557, 11448920, 11960290, 11964079, 12096923, 12420218, 1253119, 12566311, 1260746, 12636102, 12660644, 12706680, 12719706, 12820382, 12901279, 14578465, 1500216, 15448734, 15564136, 15781631, 16388317, 16507098, 17096339, 17447064, 17687334, 18375392, 1905198, 19096041, 19118044, 1962152, 19645077, 2067130, 20889724, 21116205, 21343933, 23265355, 23963772, 24114705, 24885395, 24888652, 2496918, 25311262, 25449428, 26245738, 26889977, 2720685, 27699609, 28178692, 28185003, 28290141, 28291565, 28646161, 28693131, 28985840, 29122010, 29270608, 29502035, 29720400, 29734875, 29806630, 29876002, 29953262, 29976566, 29997989, 30198422, 30382917, 30458796, 30473216, 30666318, 30854138, 30941323, 31016378, 31021492, 31028570, 31192764, 31581071, 31799750, 31809747, 6871845, 7501974, 7641207, 7688074, 7954255, 7961830, 7962522, 8453631, 8765974, 9603473, 9645743, 9734398, 9796980		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	11964079, 12636102		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	1290028, 16507098, 17695460, 28478638, 3033671, 30898149, 3167826, 6200032, 6498810		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	14500642, 16504122, 35154495	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10340466, 10341879, 10424738, 10608354, 10610624, 10815889, 10964326, 11044357, 11121864, 11151060, 11257394, 11266372, 11289125, 11418309, 11724328, 11731437, 11805572, 11852336, 11956093, 12215164, 12682539, 12783317, 12820382, 12820473, 1290028, 1431347, 14512395, 14578465, 14592671, 14648708, 1475624, 1495747, 15102666, 15185002, 15185350, 15300574, 15349105, 15355906, 15510175, 15627885, 16035616, 16049286, 16122885, 16691638, 16736329, 16739357, 16788936, 17200912, 17211733, 17406027, 17487561, 17510406, 17587345, 17649779, 1771385, 17786336, 17963306, 18043108, 18266979, 18440486, 18616803, 18672360, 18845519, 19341726, 19513549, 1962152, 19724858, 19728052, 19904275, 20178447, 20211203, 20336782, 20395351, 20682997, 20700061, 20704532, 20889724, 21042730, 21157973, 2125040, 21271227, 21301835, 21515679, 21618511, 21680300, 21725636, 21765952, 21771877, 21863385, 21874254, 21901559, 22006279, 22071131, 22267181, 22362391, 2268282, 22729559, 22975639, 22993316, 23049919, 23077639, 23296402, 23300952, 23340976, 23494669, 23657083, 23792260, 24114705, 24293105, 24451945, 24686242, 24705249, 24726916, 24783267, 24861485, 24925595, 24941225, 25075038, 25381814, 25484061, 25655760, 25785486, 25956394, 26044651, 26345965, 26494939, 26556959, 26653562, 27126992, 27127120, 27133379, 27165139, 27282379, 27307307, 27583792, 27701415, 27726312, 27813496, 27999449, 28011514, 28012211, 28126888, 28128739, 28178692, 28206963, 28251467, 28282381, 28299463, 28315907, 28376235, 28393252, 28404964, 28444968, 28481810, 28494367, 28498444, 28508837, 28588612, 28588683, 28596563, 28617240, 28622612, 28685148, 28791678, 28792134, 28838211, 28903373, 28918830, 28922620, 28943952, 28977916, 28986585, 29026949, 29033369, 29074220, 29105339, 29119017, 29156712, 29168585, 29234589, 29238715, 29284496, 29304557, 29358866, 29361435, 29375744, 29377980, 29416702, 29426902, 29459645, 29507546, 29511596, 29517661, 29535803, 29540729, 29565485, 29579327, 29636621, 29642865, 29715435, 29735609, 29756328, 29800179, 29851794, 29910683, 29939072, 29968766, 30008744, 30047185, 30058685, 30064475, 30066426, 30075754, 30087357, 30106441, 30273198, 30290664, 30321546, 30338661, 30363700, 30470940, 30556647, 30592316, 30604158, 30615587, 30653264, 30662523, 30670480, 30770895, 30776583, 30778384, 30805037, 30822523, 30852955, 30854125, 30854572, 30905451, 30915591, 30941323, 30946316, 30978169, 30980318, 31028570, 31046485, 31086125, 31179210, 31183614, 31218761, 31316143, 31397210, 31420913, 31423284, 31424670, 31496807, 31536481, 31543685, 31632476, 31669510, 31689796, 31707381, 31747664, 31757017, 31781302, 31787749, 31802190, 31815661, 31819776, 31820210, 31828541, 3568033, 3816909, 7478590, 7512130, 7600563, 7757961, 7806520, 8055923, 8398296, 8607023, 8608572, 8876893, 9014772, 9135525, 9250164, 9645743, 9654079, 9697262, 9754658		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12237895, 16804977, 18846401		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	12794582, 1290028, 14741781, 16061685, 17487559, 2119252, 24686242, 7501974		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17447064, 22458985, 24070190, 26673628, 27583792, 29720400, 29756328, 29910683, 32839292, 34092615, 34394073, 35154495, 36691026, 36931635, 37816733, 37942534	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30255816	Stimulate	★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	24586698, 27806633, 29208940, 31059014		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28374447		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	19637360	Inhibit	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	34394073	Stimulate	★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	19249035, 26253016, 31220640		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	824719		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	29039976		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29302932, 31002428, 667794		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28653772, 29302932, 31002428, 667794		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	29302932		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28133696, 29302932, 31086125		★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	1690076		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	7690349		★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa	Epidermolysis Bullosa	BEFREE	458187		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	19147569		★☆☆☆☆ Found in Text Mining only
Esophageal Atresia	Esophageal Atresia	BEFREE	28953251		★☆☆☆☆ Found in Text Mining only
Esophageal atresia with or without tracheoesophageal fistula	Tracheoesophageal fistula	BEFREE	28953251		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	10644939, 11751499, 11882818, 17062668, 18082938, 18459988, 28875338, 29181066, 9875777		★☆☆☆☆ Found in Text Mining only
Esophageal Diseases	Esophageal Diseases	BEFREE	9875777		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	10644939, 11751499, 11882818, 17062668, 18082938, 18459988, 28875338, 29181066, 9875777		★☆☆☆☆ Found in Text Mining only
Esophageal Stenosis	Esophageal Stenosis	BEFREE	29731639		★☆☆☆☆ Found in Text Mining only
Esophageal Stricture	Esophageal Stricture	BEFREE	29731639		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma-primitive neuroectodermal tumor (PNET)	Ewing sarcoma	BEFREE	11508817		★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	28508195		★☆☆☆☆ Found in Text Mining only
Eyelid Xanthoma	Eyelid Xanthoma	BEFREE	29209116		★☆☆☆☆ Found in Text Mining only
Familial medullary thyroid carcinoma	Medullary thyroid carcinoma	BEFREE	17931047		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	15855928		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	28373474, 29069888, 29865040, 30191731, 31354079		★☆☆☆☆ Found in Text Mining only
Gardner Syndrome	Gardner Syndrome	BEFREE	6851804		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	21040522, 26374829, 29072067, 31490893		★☆☆☆☆ Found in Text Mining only
Gastric Cardia Carcinoma	Gastric Cardia Carcinoma	BEFREE	28293089		★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	26374829	Stimulate	★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	26374829		★☆☆☆☆ Found in Text Mining only
Gastrointestinal carcinoma	Gastrointestinal carcinoma	BEFREE	12684893		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	10436809		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	15888344		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	24070190	Associate	★☆☆☆☆ Found in Text Mining only
Gastroschisis	Gastroschisis	Pubtator	32163230	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	12750267, 15448734, 18576918, 28228086		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	12750267, 15448734, 18576918, 28228086		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	14578465, 18576918, 22185260		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	11843246, 12820473		★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	16122885, 31444293		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	28133696		★☆☆☆☆ Found in Text Mining only
Hypoalbuminemia	Hypoalbuminemia	BEFREE	18794066, 28161931, 30578740		★☆☆☆☆ Found in Text Mining only
Hypohidrosis	Hypohidrosis	BEFREE	28295553		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29094803, 29672761		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	23757164		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	19637360	Inhibit	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	27943017, 30198422, 31133507		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	34394073	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	26374829, 38221567	Stimulate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	12460911, 15150127		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	27259014, 28602056, 29887261, 30210635, 30910867, 31231916		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	14534701		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	33592582	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10680884, 11389081, 17133484, 21922136, 22431178, 23903757, 25199534, 27741326, 28314278, 29546505, 29720829, 30196987, 30220970, 30358203, 30896845, 31205886, 31409008, 9034729		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	31205886, 6673057		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	30896845		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	18513434, 26260621, 29970696		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	37121213	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	1337798, 18664559, 20090913, 24377567, 37121213	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	14566828, 18083270		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	18664559, 19342971, 26516139, 8386136		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22195770, 32048177, 40379788	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	27046094		★☆☆☆☆ Found in Text Mining only
Lynch Syndrome	Lynch Syndrome	BEFREE	31444293		★☆☆☆☆ Found in Text Mining only
Malignant Mesothelioma of Peritoneum	Peritoneal mesothelioma	BEFREE	26729015, 29048219		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10516681, 10564638, 10592099, 10961688, 11553856, 11592097, 12677091, 12820473, 14534701, 14555509, 15508191, 16254457, 16642271, 19276164, 19787229, 20586026, 21594664, 22274803, 22692639, 22782345, 23389917, 23525470, 25832000, 25976781, 26892612, 27909883, 28112857, 28203552, 28228086, 28869448, 28969044, 29433529, 29701836, 29854028, 29854296, 29936704, 30029406, 30214602, 30535933, 30825229, 30843272, 30924846, 31247453, 31285868, 31312932, 31364001, 31412345, 31653144, 31742206, 7914825, 9544822		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	10644939, 11751499, 11882818, 12110793, 17062668, 18082938, 18459988, 28875338, 29181066, 9875777		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	18818710, 20935395, 29069888, 29995783, 31354079		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	11053994, 1330929, 1860736, 21515679, 28011514, 29545628, 29872151, 29895542, 30169666, 30303958, 9472783		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	28505148, 29522296		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	23300138, 28011514, 29895542		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	1330929, 15623614, 18823584, 19342971, 22099873, 22129186, 22274803, 24072496, 24870738, 25425729, 25961003, 26260621, 26605871, 26782458, 27080225, 27988480, 28110687, 28117344, 28152979, 28229299, 28411630, 28487728, 28514755, 28586008, 28607926, 28744310, 28940455, 29094803, 29247745, 29412152, 29435038, 29528442, 29731641, 29780629, 29970696, 30032839, 30245753, 30672447, 30903516, 30905451, 31072477, 31128008, 31319980, 31374012, 31410309, 31548657, 31568496, 31646071, 7638808, 7678982, 7923150		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	14578465, 16551872, 28228086, 31399054, 31590408		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	10414697, 11096345, 15473694, 18039393, 19763694, 22261331, 22382453, 25409014, 27639768, 28011514, 28267695, 28375170, 28710313, 28979147, 29436617, 30216455, 30346475, 30584422, 30829612, 31030989, 31031206, 31223261, 31676359, 9488584, 9617353		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11418309, 15490975, 17108217, 18973133, 19066888		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	10340466, 10928170, 11796012, 12469223, 12820444, 12854131, 14760382, 15154633, 16477642, 16552810, 16778108, 16825900, 17487561, 17667927, 17695446, 17936797, 19670418, 21419474, 23787496, 24155213, 24305936, 24378872, 26063956, 26134263, 26374829, 26559090, 27184562, 27282379, 27566604, 28096682, 28211613, 28293741, 28373470, 28440473, 28441659, 28883649, 28903321, 28977972, 29358864, 29476736, 29483954, 29729233, 29742692, 29971670, 30223387, 30303958, 30838449, 31055693, 31308753, 31347325, 31750248, 31766266, 31850212, 8640823, 8898638, 9070891, 9331089		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	10870026		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	9185702		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10360830, 10519403, 10632322, 10644939, 10788810, 10888773, 11023196, 11131674, 11289125, 11384768, 11724328, 11745423, 11960290, 12168869, 1260660, 12749728, 12901279, 1377668, 15013581, 15077926, 15173012, 15289240, 15355906, 15781631, 15888344, 16096014, 16203775, 16243831, 16332726, 16388317, 16427547, 16507098, 16510209, 16945335, 17096339, 17177160, 17224635, 17447064, 17657737, 17687334, 18262345, 18577244, 18812201, 18818710, 18937552, 19066888, 19144442, 19276164, 19686851, 20411433, 21526393, 21869824, 21871012, 22261331, 22870330, 23049919, 23300138, 23525470, 23624851, 23787496, 23884752, 24195644, 24293105, 24327292, 2438285, 24523528, 24686242, 25454718, 25832000, 26005859, 27038681, 27080225, 27282379, 27754959, 27760255, 27813496, 27875751, 27909883, 27943017, 28008574, 28078467, 28209483, 28237067, 28254228, 28280354, 28315907, 28424202, 28427079, 28503788, 28505148, 28561881, 28570780, 28586008, 28588612, 28609359, 28656881, 28660319, 28709876, 28802749, 28917774, 29050322, 29055194, 29113658, 29149688, 29285261, 29304557, 29339034, 29380595, 29412942, 29486474, 29545628, 29656061, 29689706, 29774483, 29805626, 30021922, 30028540, 30076725, 30214303, 30233867, 30271165, 30326857, 30342231, 30354850, 30390322, 30458796, 30480367, 30905451, 31018036, 31076624, 31083150, 31088185, 31092444, 31111221, 31130476, 31133507, 31295447, 31319269, 31357174, 31408453, 31422222, 31424670, 31441048, 31444293, 31476248, 31533681, 31536930, 31666285, 31676359, 31782436, 31785151, 31802190, 31828452, 31829549, 3670312, 6498810, 667794, 6851804, 709527, 7512130, 7638808, 8608572, 8813148, 9001565, 9070891, 9645743, 9736412, 9754658		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	28228086		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	30115364		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	9570998		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10399951, 10778949, 10789557, 11448920, 11964079, 12420218, 1253119, 12636102, 12660644, 12706680, 12719706, 12820382, 1290028, 12901279, 14578465, 15448734, 15564136, 16507098, 17096339, 17447064, 17687334, 19096041, 19118044, 19276164, 19645077, 20889724, 21343933, 23963772, 24114705, 24885395, 24888652, 25311262, 25449428, 26245738, 2720685, 27699609, 28178692, 28185003, 28290141, 28291565, 28646161, 28693131, 28985840, 29122010, 29270608, 29502035, 29720400, 29734875, 29806630, 29876002, 29953262, 29976566, 29997989, 30198422, 3033672, 30382917, 30458796, 30473216, 30666318, 30854138, 30941323, 31016378, 31021492, 31028570, 31192764, 31581071, 31799750, 31809747, 6871845, 9645743, 9734398, 9796980		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	11384768, 17059329, 22199345		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	30579185		★☆☆☆☆ Found in Text Mining only
Marinesco-Sjogren syndrome	Marinesco-Sjogren Syndrome	BEFREE	18004081		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	11720443, 14962731, 17931047, 18685492, 19815051, 20351352, 20627492, 22209341, 23676418, 23861463, 25319874, 25781697, 28546130, 28585679, 28614009, 28646462, 28943896, 29284496, 29895542, 29909163, 30358622, 30562193, 30684230, 31192151, 31214593, 31494787, 31602360, 31619220, 31841033, 476574, 7666591		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	14578465, 15448734, 6236377		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	16504122	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	12046609, 1464814, 21574263, 23265355, 29048219, 30354850		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	18539642		★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	11044357, 31263674, 31828452		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	28467980		★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	14608545		★☆☆☆☆ Found in Text Mining only
Multiple endocrine neoplasia Type 2	Multiple Endocrine Neoplasia	BEFREE	476574		★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 2a	Multiple Endocrine Neoplasia	BEFREE	476574		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	11311337		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	1069137		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	3356015		★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	24072496, 27990560, 28127951, 28237067, 28386154, 28506100, 29312729, 30233867, 30390322, 30651075, 31550262		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30827085		★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	BEFREE	7666591		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	1000501, 10081486, 10202129, 10203059, 10360830, 10414697, 10424738, 10516681, 10566533, 10592099, 10632322, 10632355, 10656428, 10757021, 10757026, 10757396, 10789557, 10838662, 10870026, 10888773, 10964326, 11021590, 11044357, 11053994, 11121864, 11196189, 11309650, 11326685, 11384768, 11395375, 11401322, 11508817, 11517330, 11720443, 11731437, 11733966, 11745423, 11790722, 11882819, 11896570, 11925606, 11960290, 11964079, 12174941, 12231531, 12374692, 12420861, 1253119, 12553071, 12566311, 12576435, 12605177, 12677091, 12682539, 12706680, 12719706, 12738714, 12738742, 12750267, 12801635, 12813580, 12854131, 1290028, 1330929, 1377668, 1431347, 14534701, 14564514, 14592671, 14728946, 14741781, 1500216, 15041966, 15125748, 15150127, 15175889, 15199247, 15234219, 1525759, 15330208, 15349105, 15353040, 15448734, 15455346, 15508191, 15572086, 15580629, 15627885, 15645130, 15717328, 15788693, 15855015, 15868897, 15888344, 16035616, 16040807, 16122885, 16188919, 16203775, 16231316, 16332726, 16388317, 16391782, 16409127, 16428481, 16510209, 16536871, 1653760, 16552337, 16632476, 16642271, 16739357, 16788243, 16824645, 16895556, 16945335, 17062668, 17096339, 17195459, 17200912, 17201906, 17211733, 17273749, 17487559, 17510406, 17649779, 17657737, 1771385, 17931047, 18039393, 18266979, 18334831, 18375392, 1846312, 18552144, 18577244, 18616803, 18812201, 18937552, 18973133, 19018254, 19118044, 19144442, 19276164, 1928560, 19342971, 19401768, 19577877, 19645077, 20191032, 20211203, 20361185, 20386466, 20616575, 20660959, 2067130, 20869080, 21116205, 2119252, 21264513, 21271227, 21331451, 21515679, 21594664, 21678109, 21869824, 21871012, 21874254, 22006279, 22143889, 22154301, 22261331, 22267181, 22378346, 22465428, 22574157, 22593440, 22692639, 22729559, 22855148, 23009685, 23150200, 23175797, 2317759, 23389917, 23575399, 23613396, 23676418, 23787496, 23845693, 24018822, 2418959, 24242212, 24293105, 24327292, 24332554, 24388361, 24870738, 24885395, 24888652, 2496918, 24996800, 25103018, 25119103, 25128841, 25157763, 25158256, 25449428, 25526474, 25608838, 25632185, 25792472, 26005859, 26026118, 26044651, 26134263, 26158863, 26162539, 26211594, 26261586, 26374823, 26458650, 26472090, 26486326, 26596835, 26662658, 26683939, 26861458, 26911181, 26962969, 26995061, 27037842, 27038681, 27045576, 27046094, 27059858, 27080226, 27126992, 27165139, 27197581, 27234640, 27345726, 27380811, 27395416, 27459628, 27514845, 27639768, 27660258, 27699609, 27717528, 27813496, 27825889, 27911876, 27913835, 27999449, 28008574, 28072692, 28110503, 28126888, 28128739, 28150330, 28228146, 28228152, 28232604, 28287320, 28293741, 28295553, 28315907, 28328955, 28330468, 28344808, 28404964, 28405498, 28415583, 28440473, 28468582, 28470575, 28476816, 28488013, 28498444, 28503788, 28544609, 28549012, 28562348, 28575869, 28596788, 28597039, 28607926, 28646161, 28682968, 28710725, 28733646, 28739766, 28817371, 28830616, 28852317, 28877221, 28884049, 28903373, 28916426, 28927116, 28957811, 28972047, 28978084, 28991081, 29026949, 29049328, 29064002, 29072067, 29088720, 29113665, 29135093, 29156712, 29179513, 29191601, 29208940, 29212734, 29221688, 29358864, 29374731, 29377980, 29455841, 29463551, 29466971, 29472801, 29476736, 29489510, 29499718, 29511596, 29540729, 29545628, 29559793, 29581756, 29611386, 29623266, 29691844, 29699526, 29729233, 29735609, 29743887, 29748014, 29755559, 29757961, 29766245, 29784873, 29805443, 29854296, 29858657, 29895542, 29909163, 29909485, 29922930, 29940763, 29952949, 29980531, 30022384, 30028540, 30043215, 30080722, 30103457, 30160115, 30178907, 30198356, 30198422, 30233867, 30235009, 30250539, 30267981, 30269082, 30273860, 30280434, 30303958, 30334899, 3033672, 30378010, 30404612, 30410602, 30458734, 30462849, 30535933, 30541485, 30544384, 30570865, 30575318, 30581482, 30588645, 30651116, 30651572, 30653264, 30658711, 30666318, 30726099, 30739186, 30770895, 30822523, 30826293, 30838449, 30852740, 30854063, 30854125, 30854572, 30863104, 30866983, 30887570, 30888590, 30932882, 30941954, 31001799, 31018036, 31021492, 31028213, 31028570, 31030989, 31088643, 31102323, 31127706, 31128008, 31151431, 31171910, 31214593, 31291464, 31300050, 31312384, 31312932, 31331813, 31341368, 31354079, 31409008, 31410852, 31412345, 31422222, 31424643, 31433148, 31447404, 31543685, 31548657, 31568496, 31577724, 31614135, 31617008, 31653144, 31781302, 31782840, 31791874, 31802190, 31805975, 31819776, 31828452, 31828541, 3356015, 3442732, 3568033, 3754176, 3802011, 3816909, 61812, 6200032, 6236377, 6498810, 6821838, 6848199, 7501974, 7578407, 7600563, 7621253, 7638808, 7678982, 7688074, 7690349, 7757961, 7823569, 7882341, 7914825, 8047987, 8102353, 8150543, 8276377, 8317550, 8398296, 8544456, 8607023, 8632066, 8818643, 8862512, 8898638, 9014772, 9047255, 9070891, 9101413, 9178479, 9331089, 9436861, 9530889, 9570998, 9620446, 9684100, 9732951, 9754658, 9755875, 9823867, 9935237, 9973217		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	29790264, 31132652		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	22796607		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	28315508, 30115364		★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	30868576		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	10568179, 1330929, 15865065, 16320073, 16809939, 17201906, 17363569, 17413979, 19144442, 19384943, 19897851, 22252332, 22869475, 24870738, 24922695, 24934364, 25731731, 25904302, 26077695, 26200270, 26683939, 26880855, 27072247, 27072585, 27080225, 27216449, 28121629, 28173108, 28203421, 28278517, 28456790, 28586008, 28784052, 28870944, 28870949, 28967066, 28969060, 29088833, 29332328, 29356357, 29374744, 29383158, 29413049, 29430184, 29607142, 29630519, 29748014, 29805626, 29869537, 30201371, 30216488, 30250538, 30407700, 30555348, 30572331, 30804354, 30849967, 31028213, 31146974, 31298376, 31319996, 31367536, 31372273, 31374012, 31793656, 7638808		★☆☆☆☆ Found in Text Mining only
Norrie disease	Norrie Disease	BEFREE	3568033		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28567513, 30838183		★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	12552978, 30252696		★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	31399054		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	14578465, 16551872, 28228086, 29572791, 29978587, 31399054, 31590408, 7690349		★☆☆☆☆ Found in Text Mining only
Paget Disease	Paget disease	BEFREE	12552978, 30252696		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	10414697, 11096345, 18039393, 19763694, 22261331, 22367363, 22382453, 25409014, 27639768, 28011514, 28267695, 28375170, 28710313, 28979147, 29436617, 30216455, 30346475, 30584422, 30929285, 31030989, 31031206, 31223261, 31676359, 8047987, 8950323, 9617353		★☆☆☆☆ Found in Text Mining only
Pancreatic Cyst	Pancreatic cyst	Pubtator	19136908, 37212422	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Cyst	Pancreatic Cyst	BEFREE	19249035, 23127529, 24639398, 26253016, 27514845, 27609484, 28110503, 28424202, 28516310, 29241991		★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic Diseases	BEFREE	31031206, 31223261		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	30161074, 31171910		★☆☆☆☆ Found in Text Mining only
Pancreatic Endocrine Carcinoma	Pancreatic Endocrine Carcinoma	BEFREE	10777194, 30308534		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	10757026, 11289125		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	24471499, 36494785	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	8950323		★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	24476519	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	28915633		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	30186486		★☆☆☆☆ Found in Text Mining only
Paraplegia	Paraplegia	BEFREE	28501434		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	22984996		★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	26516139, 26662658, 27565915, 28127951, 29997989, 30008860, 31028099, 8833988		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	31295447		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	29039976		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	21470677		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	27943017, 29208940		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11418309, 15490975, 17108217, 18973133, 19066888		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	16568082		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	29686080	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Alveolar Proteinosis	Alveolar proteinosis	BEFREE	31827650		★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	7638808		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	16400510, 17589956, 21271227, 22071131, 28291565, 29103468, 29580202, 29615840, 29774483, 29845570, 29876002, 29996133, 30003724, 30271165, 30458734, 31373223, 31543685, 31588705, 31700883, 31799750		★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	LHGDN	17589956		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	28505148, 29522296		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23158209		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	28660319	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	1260660, 8910043		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	8813148		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	21157437, 23625655, 23657083, 24726916, 25608838, 25956394, 26374823, 27234640, 28008623, 28494536, 28730771, 28817371, 29044941, 29064002, 29388498, 29400662, 29402836, 29755670, 29872151, 30194188, 30496943, 30519327, 30671635, 30805037, 31517873		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	19342971		★☆☆☆☆ Found in Text Mining only
Sialic Acid Storage Disease, Finnish Type (disorder)	Sialic Acid Storage Disease	BEFREE	28494536, 29344201		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	31086125		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	2438285, 28186176, 28202209, 28967066, 29211356, 29308305, 30233236, 30849967		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	1337798	Associate	★☆☆☆☆ Found in Text Mining only
Splenic Neoplasms	Splenic Neoplasms	BEFREE	9062390		★☆☆☆☆ Found in Text Mining only
Sporadic Retinoblastoma	Retinoblastoma	BEFREE	1260660		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	12231531, 12605177, 17062668, 22869475, 27793056, 29679420, 29765230, 30028540, 30115364, 31650302, 8603367		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	12605177, 17062668, 25001061, 29040480, 29285292, 29491120, 29849819, 30988139, 31151431, 31650302		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	11263866, 28302176, 29748014, 30647803		★☆☆☆☆ Found in Text Mining only
Stickler syndrome, type 1	Stickler syndrome	BEFREE	16632476		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	10928170, 11454709, 11796012, 12469223, 12692839, 12820444, 12854131, 14760382, 15154633, 16477642, 16552810, 16778108, 16825900, 17487561, 17667927, 17695446, 17936797, 19670418, 21419474, 23787496, 24155213, 24305936, 24378872, 26063956, 26134263, 26374829, 26559090, 27184562, 27282379, 27566604, 28096682, 28211613, 28293741, 28373470, 28440473, 28441659, 28883649, 28903321, 28977972, 29358864, 29476736, 29483954, 29729233, 29742692, 29971670, 30223387, 30303958, 30838449, 31055693, 31308753, 31347325, 31750248, 31766266, 31850212, 8898638, 8950323, 9331089		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach Diseases	BEFREE	28903321		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	17936797		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20187983, 22195770, 24664584, 31151932, 31695778, 32816956, 36167685, 38221567	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26374829	Stimulate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	8898638		★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	28505148, 31083150		★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	25152032	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	10870026		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	10870026, 15855928		★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	25319874		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31312932		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	22993316, 24686242, 3052255		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Calculi (disorder)	Urinary Bladder Calculi	BEFREE	29223546		★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	28726535		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	31171910	Associate	★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	30221529		★☆☆☆☆ Found in Text Mining only
Xanthoma	Xanthoma	BEFREE	29209116		★☆☆☆☆ Found in Text Mining only