FST (follistatin)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 10468
Gene name Follistatin
Gene symbol FST
Synonyms (NCBI Gene)
FS
Chromosome 5
Chromosome location 5q11.2
Summary Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicin
miRNA miRNA information provided by mirtarbase database.
50
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (50)
miRTarBase ID miRNA Experiments Reference
MIRT1005519 hsa-miR-33a CLIP-seq
MIRT1005520 hsa-miR-33b CLIP-seq
MIRT1005521 hsa-miR-3679-3p CLIP-seq
MIRT1005522 hsa-miR-4446-5p CLIP-seq
MIRT1005521 hsa-miR-3679-3p CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
5
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (5)
Transcription factor Regulation Reference
BRCA1 Activation 22685544
CTNNB1 Unknown 24667650
GLI2 Activation 18319260
SMAD3 Activation 24330518
TCF4 Unknown 24667650
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
31
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (31)
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 12702211
GO:0001501 Process Skeletal system development IEA
GO:0002244 Process Hematopoietic progenitor cell differentiation IDA 15451575
GO:0005515 Function Protein binding IPI 16198295, 17991437, 20860622, 28257634, 32296183
GO:0005576 Component Extracellular region IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
136470 3971 ENSG00000134363
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P19883
Protein name Follistatin (FS) (Activin-binding protein)
Protein function Multifunctional regulatory protein whose primary function is to antagonize members of the transforming growth factor beta (TGF-beta) superfamily including activin, myostatin, GDF11 or bone morphogenetic proteins (BMPs) (PubMed:11279126, PubMed:1
PDB 2B0U , 2P6A , 3HH2 , 5JHW
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09289 FOLN 95 → 116 Follistatin/Osteonectin-like EGF domain Domain
PF07648 Kazal_2 117 → 164 Kazal-type serine protease inhibitor domain Domain
PF07648 Kazal_2 191 → 239 Kazal-type serine protease inhibitor domain Domain
PF07648 Kazal_2 269 → 316 Kazal-type serine protease inhibitor domain Domain
Tissue specificity TISSUE SPECIFICITY: Isoform 1 is the predominant isoform in serum but is undetectable in follicular fluid. In the embryo, strong expression is seen in the palatal epithelia, including the medial edge epithelial and midline epithelial seam of the palatal s
Sequence 
MVRARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGR
LSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAP
DCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCV
VDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCI
KAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEA
ACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW
Sequence length 344
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  TGF-beta signaling pathway   Antagonism of Activin by Follistatin
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
22
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (22)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ALZHEIMER DISEASE — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BREAST CANCER — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (158)
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 19308293
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenoma Adenoma BEFREE 11414477, 8784103
★★★★★
★☆☆☆☆
Found in Text Mining only
Angina, Unstable Intermediate coronary syndrome BEFREE 15261933
★★★★★
★☆☆☆☆
Found in Text Mining only
Anxiety Anxiety Disorder BEFREE 28861774, 29546864
★★★★★
★☆☆☆☆
Found in Text Mining only
Anxiety Disorders Anxiety Disorder BEFREE 28861774, 29546864
★★★★★
★☆☆☆☆
Found in Text Mining only
Arteriosclerosis Arteriosclerosis BEFREE 9409206
★★★★★
★☆☆☆☆
Found in Text Mining only
Arthropathy Arthropathy BEFREE 24577120
★★★★★
★☆☆☆☆
Found in Text Mining only
Asthma Asthma BEFREE 27807906
★★★★★
★☆☆☆☆
Found in Text Mining only
Atherosclerosis Atherosclerosis BEFREE 9409206
★★★★★
★☆☆☆☆
Found in Text Mining only
Autoimmune Diseases Autoimmune Diseases BEFREE 11124865, 31322318
★★★★★
★☆☆☆☆
Found in Text Mining only