TACC3 (transforming acidic coiled-coil containing protein 3)

Gene

• Entrez ID: 10460
• Gene name: Transforming acidic coiled-coil containing protein 3
• Gene symbol: TACC3
• Synonyms (NCBI Gene): ERIC-1, ERIC1, Tacc4, maskin
• Chromosome: 4
• Chromosome location: 4p16.3
• Summary: This gene encodes a member of the transforming acidic colied-coil protein family. The encoded protein is a motor spindle protein that may play a role in stabilization of the mitotic spindle. This protein may also play a role in growth a differentiation of

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016566	hsa-miR-193b-3p	Microarray	20304954
MIRT045607	hsa-miR-149-5p	CLASH	23622248
MIRT043259	hsa-miR-324-5p	CLASH	23622248
MIRT042910	hsa-miR-324-3p	CLASH	23622248
MIRT016566	hsa-miR-193b-3p	CLASH	23622248
MIRT040904	hsa-miR-18a-3p	CLASH	23622248
MIRT039103	hsa-miR-769-3p	CLASH	23622248
MIRT037681	hsa-miR-744-5p	CLASH	23622248
MIRT438423	hsa-miR-425-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23174883
MIRT438422	hsa-miR-152-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23174883
MIRT438421	hsa-miR-24-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23174883
MIRT438423	hsa-miR-425-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23174883
MIRT438422	hsa-miR-152-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23174883
MIRT438421	hsa-miR-24-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23174883
MIRT489756	hsa-miR-6798-5p	PAR-CLIP	23592263
MIRT489755	hsa-miR-4706	PAR-CLIP	23592263
MIRT489754	hsa-miR-4749-5p	PAR-CLIP	23592263
MIRT489753	hsa-miR-1908-5p	PAR-CLIP	23592263
MIRT489752	hsa-miR-663a	PAR-CLIP	23592263
MIRT489750	hsa-miR-6787-5p	PAR-CLIP	23592263
MIRT489751	hsa-miR-3180	PAR-CLIP	23592263
MIRT489749	hsa-miR-3180-3p	PAR-CLIP	23592263
MIRT489748	hsa-miR-3196	PAR-CLIP	23592263
MIRT489747	hsa-miR-6816-5p	PAR-CLIP	23592263
MIRT489746	hsa-miR-1237-5p	PAR-CLIP	23592263
MIRT489745	hsa-miR-4488	PAR-CLIP	23592263
MIRT489744	hsa-miR-4697-5p	PAR-CLIP	23592263
MIRT489743	hsa-miR-328-5p	PAR-CLIP	23592263
MIRT489742	hsa-miR-6885-5p	PAR-CLIP	23592263
MIRT489756	hsa-miR-6798-5p	PAR-CLIP	23592263
MIRT489755	hsa-miR-4706	PAR-CLIP	23592263
MIRT489754	hsa-miR-4749-5p	PAR-CLIP	23592263
MIRT489753	hsa-miR-1908-5p	PAR-CLIP	23592263
MIRT489752	hsa-miR-663a	PAR-CLIP	23592263
MIRT489750	hsa-miR-6787-5p	PAR-CLIP	23592263
MIRT489751	hsa-miR-3180	PAR-CLIP	23592263
MIRT489749	hsa-miR-3180-3p	PAR-CLIP	23592263
MIRT489748	hsa-miR-3196	PAR-CLIP	23592263
MIRT489747	hsa-miR-6816-5p	PAR-CLIP	23592263
MIRT489746	hsa-miR-1237-5p	PAR-CLIP	23592263
MIRT489745	hsa-miR-4488	PAR-CLIP	23592263
MIRT489744	hsa-miR-4697-5p	PAR-CLIP	23592263
MIRT489743	hsa-miR-328-5p	PAR-CLIP	23592263
MIRT489742	hsa-miR-6885-5p	PAR-CLIP	23592263
MIRT1408451	hsa-miR-1305	CLIP-seq
MIRT1408452	hsa-miR-1324	CLIP-seq
MIRT1408453	hsa-miR-1908	CLIP-seq
MIRT1408454	hsa-miR-1909	CLIP-seq
MIRT1408455	hsa-miR-2277-3p	CLIP-seq
MIRT1408456	hsa-miR-3123	CLIP-seq
MIRT1408457	hsa-miR-330-3p	CLIP-seq
MIRT1408458	hsa-miR-3605-3p	CLIP-seq
MIRT1408459	hsa-miR-4307	CLIP-seq
MIRT1408460	hsa-miR-4436a	CLIP-seq
MIRT1408461	hsa-miR-4461	CLIP-seq
MIRT1408462	hsa-miR-4496	CLIP-seq
MIRT1408463	hsa-miR-4700-3p	CLIP-seq
MIRT1408464	hsa-miR-483-5p	CLIP-seq
MIRT1408465	hsa-miR-488	CLIP-seq
MIRT1408466	hsa-miR-607	CLIP-seq
MIRT1408467	hsa-miR-627	CLIP-seq
MIRT1408468	hsa-miR-663	CLIP-seq
MIRT1408452	hsa-miR-1324	CLIP-seq
MIRT1408453	hsa-miR-1908	CLIP-seq
MIRT1408454	hsa-miR-1909	CLIP-seq
MIRT1408455	hsa-miR-2277-3p	CLIP-seq
MIRT1408456	hsa-miR-3123	CLIP-seq
MIRT1408458	hsa-miR-3605-3p	CLIP-seq
MIRT1408460	hsa-miR-4436a	CLIP-seq
MIRT1408463	hsa-miR-4700-3p	CLIP-seq
MIRT1408464	hsa-miR-483-5p	CLIP-seq
MIRT1408468	hsa-miR-663	CLIP-seq
MIRT1408452	hsa-miR-1324	CLIP-seq
MIRT1408455	hsa-miR-2277-3p	CLIP-seq
MIRT1408456	hsa-miR-3123	CLIP-seq
MIRT1408460	hsa-miR-4436a	CLIP-seq
MIRT1408463	hsa-miR-4700-3p	CLIP-seq
MIRT1408464	hsa-miR-483-5p	CLIP-seq
MIRT1408452	hsa-miR-1324	CLIP-seq
MIRT1408455	hsa-miR-2277-3p	CLIP-seq
MIRT1408456	hsa-miR-3123	CLIP-seq
MIRT1408458	hsa-miR-3605-3p	CLIP-seq
MIRT1408460	hsa-miR-4436a	CLIP-seq
MIRT1408463	hsa-miR-4700-3p	CLIP-seq
MIRT1408464	hsa-miR-483-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000226	Process	Microtubule cytoskeleton organization	IBA
GO:0000922	Component	Spindle pole	IEA
GO:0005515	Function	Protein binding	IPI	20360068, 21297582, 25416956, 26496610, 27107012, 27956147, 29892012, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005813	Component	Centrosome	IEA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0007052	Process	Mitotic spindle organization	IEA
GO:0007091	Process	Metaphase/anaphase transition of mitotic cell cycle	IMP	23532825
GO:0007097	Process	Nuclear migration	IBA
GO:0021987	Process	Cerebral cortex development	IBA
GO:0034451	Component	Centriolar satellite	IDA
GO:0036064	Component	Ciliary basal body	IDA
GO:0051301	Process	Cell division	IEA
GO:0060236	Process	Regulation of mitotic spindle organization	IMP	21297582
GO:0072686	Component	Mitotic spindle	IDA
GO:1902850	Process	Microtubule cytoskeleton organization involved in mitosis	IMP	23532825

Other IDs

• MIM: 605303
• HGNC: 11524
• e!Ensembl: ENSG00000013810

Protein

• UniProt ID: Q9Y6A5
• Protein name: Transforming acidic coiled-coil-containing protein 3 (ERIC-1)
• Protein function: Plays a role in the microtubule-dependent coupling of the nucleus and the centrosome. Involved in the processes that regulate centrosome-mediated interkinetic nuclear migration (INM) of neural progenitors (By similarity). Acts as a component of
• PDB: 5LXN, 5LXO, 5ODS, 5ODT
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05010	TACC_C	639 → 832	Transforming acidic coiled-coil-containing protein (TACC), C-terminal	Coiled-coil

• Sequence:

  MSLQVLNDKNVSNEKNTENCDFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVTFQTP
  LRDPQTHRILSPSMASKLEAPFTQDDTLGLENSHPVWTQKENQQLIKEVDAKTTHGILQK
  PVEADTDLLGDASPAFGSGSSSESGPGALADLDCSSSSQSPGSSENQMVSPGKVSGSPEQ
  AVEENLSSYSLDRRVTPASETLEDPCRTESQHKAETPHGAEEECKAETPHGAEEECRHGG
  VCAPAAVATSPPGAIPKEACGGAPLQGLPGEALGCPAGVGTPVPADGTQTLTCAHTSAPE
  STAPTNHLVAGRAMTLSPQEEVAAGQMASSSRSGPVKLEFDVSDGATSKRAPPPRRLGER
  SGLKPPLRKAAVRQQKAPQEVEEDDGRSGAGEDPPMPASRGSYHLDWDKMDDPNFIPFGG
  DTKSGCSEAQPPESPETRLGQPAAEQLHAGPATEEPGPCLSQQLHSASAEDTPVVQLAAE
  TPTAESKERALNSASTSLPTSCPGSEPVPTHQQGQPALELKEESFRDPAEVLGTGAEVDY
  LEQFGTSSFKESALRKQSLYLKFDPLLRDSPGRPVPVATETSSMHGANETPSGRPREAKL
  VEFDFLGALDIPVPGPPPGVPAPGGPPLSTGPIVDLLQYSQKDLDAVVKATQEENRELRS
  RCEELHGKNLELGKIMDRFEEVVYQAMEEVQKQKELSKAEIQKVLKEKDQLTTDLNSMEK
  SFSDLFKRFEKQKEVIEGYRKNEESLKKCVEDYLARITQEGQRYQALKAHAEEKLQLANE
  EIAQVRSKAQAEALALQASLRKEQMRIQSLEKTVEQKTKENEELTRICDDLISKMEKI

• Sequence length: 838

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, TRANSITIONAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GIANT CELL GLIOBLASTOMA	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOSARCOMA	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary breast ovarian cancer syndrome	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	28838400		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	25294908, 30344944		★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	28855393	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	22711262, 24155119, 26374428, 27930669, 29358577		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	24121792		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36864125	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28855393, 33714201	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	25188299	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26219398, 26219896	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	20348956, 22711262, 24155119, 26374428, 27930669, 28655970, 29358577		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	GWASCAT_DG	20348956, 20972438, 24163127		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	26531241		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33714201	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	24323028	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	23936413, 29358619		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	23936413, 29358619		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	24563076	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	27705912		★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	29241927	Associate	★☆☆☆☆ Found in Text Mining only
Cleft palate and bilateral cleft lip	Cleft Palate And Bilateral Cleft Lip	BEFREE	29241927		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36221072	Associate	★☆☆☆☆ Found in Text Mining only
Congenital anomaly of face	Facial dysmorphism	BEFREE	29241927		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	27705912		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	29588307	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsies Partial	Partial epilepsy	Pubtator	30220708	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	25535896, 25760075	Associate	★☆☆☆☆ Found in Text Mining only
Facial Dysmorphism with Multiple Malformations	Facial dysmorphism syndrome	Pubtator	29241927	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Glioblastoma	Giant Cell Glioblastoma	ORPHANET_DG	22837387		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Giant cell glioblastoma	Giant Cell Glioblastoma	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	BEFREE	21113414, 23298836, 23298839, 23696246, 25609060, 26134678, 26869289, 29361062		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	21113414, 27829236, 29361062, 31290679, 32949176, 33168106, 33853673, 35151844, 36002559, 36194351, 36647073	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21113414, 22837387, 23298836, 23298839, 23696246, 25609060, 26869289, 29361062		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	21113414, 25135958, 28379477, 28976058, 32413119, 32949176, 34160364, 36647073	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22837387, 23298836, 25609060, 28273854		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28273854	Stimulate	★☆☆☆☆ Found in Text Mining only
gliosarcoma	Gliosarcoma	ORPHANET_DG	22837387		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gliosarcoma	Gliosarcoma	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	32199932	Associate	★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	29135996		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	32402250	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25535896, 36042187	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	36221072	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24452392, 26531241		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29978472		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28336437		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26133271		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	20348956, 22711262, 24155119, 26374428, 27930669, 28655970, 29358577		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	GWASDB_DG	20348956, 20972438, 24163127		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	24121792		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10366448, 21685933, 23298836, 23936413, 26133271, 26869289, 28192613, 29135996, 29262532, 29323298, 29358619, 30024460		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	23936413, 29358619		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	32493317	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	BEFREE	15198734		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	15198734, 23522059	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	25535896		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	25535896	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21113414, 21685933, 22869527, 23175443, 26133271, 26374428, 27345413, 28210881, 28273854, 28336437, 29088887, 29135996, 29330265, 29358577, 29725420, 30024460		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26531241, 27956147, 28838400, 29991799		★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	33714201	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	GWASCAT_DG	30664745		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29725420, 30024460		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	30024460	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29978472		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28336437		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	32208524	Associate	★☆☆☆☆ Found in Text Mining only
Roberts Syndrome	Roberts syndrome	Pubtator	29241927	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	29135996, 30024460		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	Pubtator	29135996, 30024460	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	24323028		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	29135996		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26133271		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	17914111	Inhibit	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	17914111	Inhibit	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	27231203		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	27231203, 40179432	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Diseases	Urinary bladder diseases	Pubtator	28855393	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	20348956, 21459758, 24121792, 26374428, 32384449, 33213418, 34160364, 35151844	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	28855393	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	29358577	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23936413, 25669975	Associate	★☆☆☆☆ Found in Text Mining only
Wolf-Hirschhorn Syndrome	Wolf-Hirschhorn Syndrome	BEFREE	29241927		★☆☆☆☆ Found in Text Mining only