HAX1 (HCLS1 associated protein X-1)

Gene

• Entrez ID: 10456
• Gene name: HCLS1 associated protein X-1
• Gene symbol: HAX1
• Synonyms (NCBI Gene): HCLSBP1, HS1BP1, SCN3
• Chromosome: 1
• Chromosome location: 1q21.3
• Summary: The protein encoded by this gene is known to associate with hematopoietic cell-specific Lyn substrate 1, a substrate of Src family tyrosine kinases. It also interacts with the product of the polycystic kidney disease 2 gene, mutations in which are associa

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs74315322	C>T	Pathogenic	Stop gained, coding sequence variant
rs121908165	C>G,T	Pathogenic	Stop gained, missense variant, coding sequence variant
rs146452018	T>C,G	Likely-pathogenic	Intron variant, missense variant, coding sequence variant
rs371504152	A>G	Likely-pathogenic	Splice acceptor variant
rs745666437	G>-,GG	Pathogenic	Coding sequence variant, frameshift variant, intron variant
rs748595772	A>-	Pathogenic	Coding sequence variant, frameshift variant
rs758657008	C>-,CC	Pathogenic	Frameshift variant, intron variant, coding sequence variant
rs764082747	G>-	Pathogenic	Frameshift variant, intron variant, coding sequence variant
rs770288337	G>-,GG	Pathogenic	Coding sequence variant, frameshift variant
rs1398108109	C>G	Pathogenic	Coding sequence variant, stop gained
rs1572018284	->A	Pathogenic	Intron variant, stop gained, coding sequence variant
rs1572018886	->C	Likely-pathogenic	Coding sequence variant, frameshift variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT020740	hsa-miR-155-5p	Proteomics	18668040
MIRT043362	hsa-miR-331-3p	CLASH	23622248
MIRT450005	hsa-miR-8083	PAR-CLIP	22100165
MIRT450004	hsa-miR-4635	PAR-CLIP	22100165
MIRT450003	hsa-miR-605-3p	PAR-CLIP	22100165
MIRT450001	hsa-miR-4493	PAR-CLIP	22100165
MIRT450002	hsa-miR-6134	PAR-CLIP	22100165
MIRT450000	hsa-miR-6126	PAR-CLIP	22100165
MIRT449999	hsa-miR-6864-5p	PAR-CLIP	22100165
MIRT449998	hsa-miR-3978	PAR-CLIP	22100165
MIRT440524	hsa-miR-299-5p	HITS-CLIP	24374217
MIRT440524	hsa-miR-299-5p	HITS-CLIP	24374217
MIRT450005	hsa-miR-8083	PAR-CLIP	22100165
MIRT450004	hsa-miR-4635	PAR-CLIP	22100165
MIRT450003	hsa-miR-605-3p	PAR-CLIP	22100165
MIRT450001	hsa-miR-4493	PAR-CLIP	22100165
MIRT450002	hsa-miR-6134	PAR-CLIP	22100165
MIRT450000	hsa-miR-6126	PAR-CLIP	22100165
MIRT449999	hsa-miR-6864-5p	PAR-CLIP	22100165
MIRT449998	hsa-miR-3978	PAR-CLIP	22100165
MIRT2241116	hsa-miR-1262	CLIP-seq
MIRT2241117	hsa-miR-4506	CLIP-seq
MIRT2241118	hsa-miR-4701-3p	CLIP-seq
MIRT2437556	hsa-miR-125b	CLIP-seq
MIRT2437557	hsa-miR-3692	CLIP-seq
MIRT2437558	hsa-miR-4319	CLIP-seq
MIRT2437559	hsa-miR-544b	CLIP-seq
MIRT2437556	hsa-miR-125b	CLIP-seq
MIRT2241116	hsa-miR-1262	CLIP-seq
MIRT2544672	hsa-miR-21	CLIP-seq
MIRT2544673	hsa-miR-31	CLIP-seq
MIRT2544674	hsa-miR-3688-5p	CLIP-seq
MIRT2437557	hsa-miR-3692	CLIP-seq
MIRT2544675	hsa-miR-3921	CLIP-seq
MIRT2437558	hsa-miR-4319	CLIP-seq
MIRT2544676	hsa-miR-4477a	CLIP-seq
MIRT2241117	hsa-miR-4506	CLIP-seq
MIRT2544677	hsa-miR-4649-3p	CLIP-seq
MIRT2544678	hsa-miR-4653-5p	CLIP-seq
MIRT2241118	hsa-miR-4701-3p	CLIP-seq
MIRT2544679	hsa-miR-4757-5p	CLIP-seq
MIRT2544680	hsa-miR-541	CLIP-seq
MIRT2437559	hsa-miR-544b	CLIP-seq
MIRT2544681	hsa-miR-590-5p	CLIP-seq
MIRT2544682	hsa-miR-654-5p	CLIP-seq
MIRT2437556	hsa-miR-125b	CLIP-seq
MIRT2241116	hsa-miR-1262	CLIP-seq
MIRT2544672	hsa-miR-21	CLIP-seq
MIRT2544673	hsa-miR-31	CLIP-seq
MIRT2544674	hsa-miR-3688-5p	CLIP-seq
MIRT2437557	hsa-miR-3692	CLIP-seq
MIRT2544675	hsa-miR-3921	CLIP-seq
MIRT2437558	hsa-miR-4319	CLIP-seq
MIRT2544676	hsa-miR-4477a	CLIP-seq
MIRT2241117	hsa-miR-4506	CLIP-seq
MIRT2544677	hsa-miR-4649-3p	CLIP-seq
MIRT2544678	hsa-miR-4653-5p	CLIP-seq
MIRT2241118	hsa-miR-4701-3p	CLIP-seq
MIRT2544679	hsa-miR-4757-5p	CLIP-seq
MIRT2544680	hsa-miR-541	CLIP-seq
MIRT2437559	hsa-miR-544b	CLIP-seq
MIRT2544681	hsa-miR-590-5p	CLIP-seq
MIRT2544682	hsa-miR-654-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Unknown	19679660

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000932	Component	P-body	IEA
GO:0005515	Function	Protein binding	IPI	11554782, 16971486, 17008324, 17500595, 20171186, 20406461, 20631090, 20665473, 21217774, 21567072, 22570112, 24188827, 25036637, 25416956, 26915802, 26997484, 32814053, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	TAS	9058808
GO:0005667	Component	Transcription regulator complex	IDA	23001182
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	9058808
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IDA	17008324
GO:0005758	Component	Mitochondrial intermembrane space	IDA	17008324
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0005783	Component	Endoplasmic reticulum	TAS	9058808
GO:0005886	Component	Plasma membrane	IEA
GO:0005938	Component	Cell cortex	IEA
GO:0007005	Process	Mitochondrion organization	IMP	17008324
GO:0015629	Component	Actin cytoskeleton	IBA
GO:0015629	Component	Actin cytoskeleton	IEA
GO:0015629	Component	Actin cytoskeleton	ISS
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IBA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016529	Component	Sarcoplasmic reticulum	IBA
GO:0016529	Component	Sarcoplasmic reticulum	IEA
GO:0019904	Function	Protein domain specific binding	IEA
GO:0019966	Function	Interleukin-1 binding	IDA	11554782
GO:0030027	Component	Lamellipodium	IEA
GO:0030027	Component	Lamellipodium	ISS
GO:0030136	Component	Clathrin-coated vesicle	IBA
GO:0030136	Component	Clathrin-coated vesicle	IEA
GO:0030833	Process	Regulation of actin filament polymerization	IBA
GO:0030833	Process	Regulation of actin filament polymerization	IMP	23001182
GO:0030854	Process	Positive regulation of granulocyte differentiation	IMP	23001182
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031965	Component	Nuclear membrane	IEA
GO:0035591	Function	Signaling adaptor activity	IMP	23001182
GO:0038158	Process	Granulocyte colony-stimulating factor signaling pathway	IMP	23001182
GO:0042981	Process	Regulation of apoptotic process	TAS	24522549
GO:0043066	Process	Negative regulation of apoptotic process	IBA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	17008324
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	23001182
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	23001182
GO:0071345	Process	Cellular response to cytokine stimulus	IMP	23001182
GO:0110053	Process	Regulation of actin filament organization	IMP	23001182
GO:1903146	Process	Regulation of autophagy of mitochondrion	TAS	24522549
GO:1903214	Process	Regulation of protein targeting to mitochondrion	TAS	24522549

Other IDs

• MIM: 605998
• HGNC: 16915
• e!Ensembl: ENSG00000143575

Protein

• UniProt ID: O00165
• Protein name: HCLS1-associated protein X-1 (HS1-associating protein X-1) (HAX-1) (HS1-binding protein 1) (HSP1BP-1)
• Protein function: Recruits the Arp2/3 complex to the cell cortex and regulates reorganization of the cortical actin cytoskeleton via its interaction with KCNC3 and the Arp2/3 complex (PubMed:26997484). Slows down the rate of inactivation of KCNC3 channels (PubMed
• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. Up-regulated in oral cancers. {ECO:0000269|PubMed:17545607, ECO:0000269|PubMed:9058808}.
• Sequence:

  MSLFDLFRGFFGFPGPRSHRDPFFGGMTRDEDDDEEEEEEGGSWGRGNPRFHSPQHPPEE
  FGFGFSFSPGGGIRFHDNFGFDDLVRDFNSIFSDMGAWTLPSHPPELPGPESETPGERLR
  EGQTLRDSMLKYPDSHQPRIFGGVLESDARSESPQPAPDWGSQRPFHRFDDVWPMDPHPR
  TREDNDLDSQVSQEGLGPVLQPQPKSYFKSISVTKITKPDGIVEERRTVVDSEGRTETTV
  TRHEADSSPRGDPESPRPPALDDAFSILDLFLGRWFRSR

• Sequence length: 279

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Acute myeloid leukemia	Likely pathogenic	rs371504152	RCV005902029	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Familial cancer of breast	Likely pathogenic	rs371504152	RCV005902028	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
HAX1-related disorder	Likely pathogenic; Pathogenic	rs201707963	RCV003408320	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hepatocellular carcinoma	Pathogenic	rs2149140495	RCV005868482	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Kostmann syndrome	Pathogenic; Likely pathogenic	rs2149139668, rs758657008, rs2149139817, rs1487742962, rs2149139969, rs2149140065, rs2149140056, rs2149140690, rs1392118289, rs2149140495, rs1684904805, rs1425877227, rs2149139493, rs2149139793, rs2149139706, rs764765550, rs1684901295, rs1334392544, rs74315322, rs1572018284, rs121908165, rs2524933917, rs745666437, rs2524937073, rs2524932526, rs2524931096, rs201707963, rs2524924781, rs2524934196, rs2524933144, rs2524930480, rs2524924407, rs1684899990, rs2524930259, rs2524924329, rs764082747, rs1398108109, rs770288337, rs748595772, rs371504152, rs1572018886, rs374758765, rs41313932	RCV001384140 RCV003612288 RCV001380521 RCV001385664 RCV001824254 RCV002043583 RCV001891498 RCV002036929 RCV001930103 RCV002000231 RCV001980817 RCV001957928 RCV002002478 RCV001877730 RCV001928152 RCV001981089 RCV003080511 RCV003110845 RCV000004913 RCV000004914 RCV000004916 RCV000004917 RCV000004918 RCV000004919 RCV002885168 RCV003030755 RCV003008145 RCV003024753 RCV005104357 RCV003503860 RCV003612581 RCV003612812 RCV003613490 RCV003613478 RCV003612213 RCV003832465 RCV003865620 RCV003990121 RCV000706106 RCV000680006 RCV000702051 RCV000816591 RCV000809695 RCV000985095 RCV001071782 RCV001035759 RCV001215254	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Ovarian serous cystadenocarcinoma	Likely pathogenic	rs1684901295	RCV005930488	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Severe congenital neutropenia	Likely pathogenic; Pathogenic	rs1684901295, rs2524938045, rs764082747	RCV003111626 RCV003123456 RCV003155204	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Decreased total neutrophil count	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary insensitivity to pain with anhidrosis	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUTROPENIA, SEVERE CONGENITAL, 3, AUTOSOMAL RECESSIVE	—	HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUTROPENIA, SEVERE CONGENITAL, AUTOSOMAL RECESSIVE 3	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	12787133	Stimulate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	40118053	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20696135, 21567072, 28347249, 29434858, 29975932, 31093284, 31644363		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20196840	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28347249	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20196840	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26339377	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31132019, 33000203	Associate	★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	18513342	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	21108402	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26062578		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32104694	Associate	★☆☆☆☆ Found in Text Mining only
Congenital neutropenia	Congenital Neutropenia	BEFREE	17187068, 17917547, 17989524, 18043240, 18055975, 18330843, 18337561, 18513342, 18611981, 19036076, 19120359, 19123440, 19499579, 19524642, 19775295, 19811314, 20128427, 20182745, 21206270, 21796505, 23050867, 23206890, 23975175, 24482108, 25597510, 26637693, 26994629, 27943080, 28681255, 30473482, 30698159, 31321910		★☆☆☆☆ Found in Text Mining only
Congenital neutropenia	Congenital Neutropenia	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Congenital neutropenia	Congenital Neutropenia	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Craniosynostoses	Craniosynostosis	Pubtator	20220065	Associate	★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	18055975	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	18055975		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	18055975, 18337561, 18513342, 21108402, 26994629	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	23531395	Associate	★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher Disease	BEFREE	30473482		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30766479		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30766479		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28751207		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	18055975, 18611981		★☆☆☆☆ Found in Text Mining only
Growth Retardation Developmental Delay Coarse Facies And Early Death	Growth retardation, developmental delay, coarse facies, and early death	Pubtator	26994629	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	35524442	Associate	★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	18611981		★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	30040071	Associate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	18055975, 18337561	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	18055975	Associate	★☆☆☆☆ Found in Text Mining only
Kostmann syndrome	Kostmann Syndrome	Orphanet			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
leukemia	Leukemia	BEFREE	17989524		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	25298122	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	17537008, 20128427, 28169428, 30473482		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	17545607		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26339377, 31047882		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	20196840	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23531395, 32926529	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphedema	Lymphedema	Pubtator	21108402	Associate	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	28169428	Associate	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	BEFREE	28169428		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20696135, 21567072, 28347249, 29434858, 29975932, 31093284, 31644363		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	17545607		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26062578, 28347249, 28791389		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	25419709		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	12787133		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	12787133	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	20196840	Stimulate	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	37556141	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Myeloproliferative Syndrome Transient	Transient myeloproliferative disorder	Pubtator	20220065	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	35524442	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22451114, 25419709, 28791389		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	21108402	Associate	★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	18330843		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	LHGDN	17187068, 18330843, 18611981		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	17537008, 20128427, 28169428, 30473482		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	20220065, 23454784, 28169428	Associate	★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Neutropenia Severe Congenital Autosomal Recessive 3	Severe congenital neutropenia	Pubtator	18055975, 18337561, 18513342, 19036076, 19123440, 19398129, 19775295, 20128427, 20220065, 21108402, 21518791, 21891829, 22624626, 23454784, 23975175, 26637693, 26994629, 28169428, 30040071, 33560392, 36230905, 37993852	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	28681255		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	21796505		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	12787133		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	LHGDN	12787133, 18399350		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	12787133	Stimulate	★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	26994629	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	37993852	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	22451114, 23531395		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28791389	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the hypopharynx	Hypopharyngeal Carcinoma	BEFREE	28791389		★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	Pubtator	26994629	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	16971486		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	LHGDN	18399350		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	27618431	Associate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	21108402	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33015771	Associate	★☆☆☆☆ Found in Text Mining only
Wiskott-Aldrich Syndrome	Wiskott-Aldrich Syndrome	BEFREE	19036076		★☆☆☆☆ Found in Text Mining only