Gene Gene information from NCBI Gene database.
Entrez ID 10456
Gene name HCLS1 associated protein X-1
Gene symbol HAX1
Synonyms (NCBI Gene)
HCLSBP1HS1BP1SCN3
Chromosome 1
Chromosome location 1q21.3
Summary The protein encoded by this gene is known to associate with hematopoietic cell-specific Lyn substrate 1, a substrate of Src family tyrosine kinases. It also interacts with the product of the polycystic kidney disease 2 gene, mutations in which are associa
SNPs SNP information provided by dbSNP.
12
SNP ID Visualize variation Clinical significance Consequence
rs74315322 C>T Pathogenic Stop gained, coding sequence variant
rs121908165 C>G,T Pathogenic Stop gained, missense variant, coding sequence variant
rs146452018 T>C,G Likely-pathogenic Intron variant, missense variant, coding sequence variant
rs371504152 A>G Likely-pathogenic Splice acceptor variant
rs745666437 G>-,GG Pathogenic Coding sequence variant, frameshift variant, intron variant
miRNA miRNA information provided by mirtarbase database.
63
miRTarBase ID miRNA Experiments Reference
MIRT020740 hsa-miR-155-5p Proteomics 18668040
MIRT043362 hsa-miR-331-3p CLASH 23622248
MIRT450005 hsa-miR-8083 PAR-CLIP 22100165
MIRT450004 hsa-miR-4635 PAR-CLIP 22100165
MIRT450003 hsa-miR-605-3p PAR-CLIP 22100165
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
NFKB1 Unknown 19679660
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
50
GO ID Ontology Definition Evidence Reference
GO:0000932 Component P-body IEA
GO:0005515 Function Protein binding IPI 11554782, 16971486, 17008324, 17500595, 20171186, 20406461, 20631090, 20665473, 21217774, 21567072, 22570112, 24188827, 25036637, 25416956, 26915802, 26997484, 32814053, 33961781
GO:0005634 Component Nucleus IEA
GO:0005635 Component Nuclear envelope TAS 9058808
GO:0005667 Component Transcription regulator complex IDA 23001182
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605998 16915 ENSG00000143575
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O00165
Protein name HCLS1-associated protein X-1 (HS1-associating protein X-1) (HAX-1) (HS1-binding protein 1) (HSP1BP-1)
Protein function Recruits the Arp2/3 complex to the cell cortex and regulates reorganization of the cortical actin cytoskeleton via its interaction with KCNC3 and the Arp2/3 complex (PubMed:26997484). Slows down the rate of inactivation of KCNC3 channels (PubMed
Family and domains
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. Up-regulated in oral cancers. {ECO:0000269|PubMed:17545607, ECO:0000269|PubMed:9058808}.
Sequence
MSLFDLFRGFFGFPGPRSHRDPFFGGMTRDEDDDEEEEEEGGSWGRGNPRFHSPQHPPEE
FGFGFSFSPGGGIRFHDNFGFDDLVRDFNSIFSDMGAWTLPSHPPELPGPESETPGERLR
EGQTLRDSMLKYPDSHQPRIFGGVLESDARSESPQPAPDWGSQRPFHRFDDVWPMDPHPR
TREDNDLDSQVSQEGLGPVLQPQPKSYFKSISVTKITKPDGIVEERRTVVDSEGRTETTV
TRHEADSSPRGDPESPRPPALDDAFSILDLFLGRWFRSR
Sequence length 279
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
13
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Acute myeloid leukemia Likely pathogenic rs371504152 RCV005902029
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Familial cancer of breast Likely pathogenic rs371504152 RCV005902028
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
HAX1-related disorder Likely pathogenic; Pathogenic rs201707963 RCV003408320
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hepatocellular carcinoma Pathogenic rs2149140495 RCV005868482
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
BIPOLAR DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Decreased total neutrophil count Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Hereditary insensitivity to pain with anhidrosis Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
NEUTROPENIA, SEVERE CONGENITAL, 3, AUTOSOMAL RECESSIVE HPO
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Arthritis Psoriatic Psoriatic arthritis Pubtator 12787133 Stimulate
★☆☆☆☆
Found in Text Mining only
Ataxia Telangiectasia Ataxia telangiectasia Pubtator 40118053 Associate
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 20696135, 21567072, 28347249, 29434858, 29975932, 31093284, 31644363
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 20196840 Stimulate
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 28347249 Associate
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 20196840 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 26339377 Stimulate
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 31132019, 33000203 Associate
★☆☆☆☆
Found in Text Mining only
Central Nervous System Diseases Central nervous system disease Pubtator 18513342 Associate
★☆☆☆☆
Found in Text Mining only
Cognition Disorders Cognition disorder Pubtator 21108402 Associate
★☆☆☆☆
Found in Text Mining only