CDX2 (caudal type homeobox 2)

Gene

• Entrez ID: 1045
• Gene name: Caudal type homeobox 2
• Gene symbol: CDX2
• Synonyms (NCBI Gene): CDX-3, CDX2/AS, CDX3
• Chromosome: 13
• Chromosome location: 13q12.2
• Summary: This gene is a member of the caudal-related homeobox transcription factor gene family. The encoded protein is a major regulator of intestine-specific genes involved in cell growth an differentiation. This protein also plays a role in early embryonic devel

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1593181774	A>G	Likely-pathogenic	Stop lost, terminator codon variant, 3 prime UTR variant, genic downstream transcript variant, downstream transcript variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000245	hsa-miR-181a-5p	Luciferase reporter assay	19585654
MIRT000240	hsa-miR-181b-5p	Luciferase reporter assay	19585654
MIRT000235	hsa-miR-181c-5p	Luciferase reporter assay	19585654
MIRT005783	hsa-miR-9-5p	Flow, Immunohistochemistry, Luciferase reporter assay, Western blot	21225631
MIRT005783	hsa-miR-9-5p	Flow, Immunohistochemistry, Luciferase reporter assay, Western blot	21225631
MIRT005784	hsa-miR-204-5p	Luciferase reporter assay	21225631
MIRT018670	hsa-miR-335-5p	Microarray	18185580
MIRT042133	hsa-miR-484	CLASH	23622248
MIRT053379	hsa-miR-424-5p	Luciferase reporter assay, qRT-PCR, Western blot	23801117
MIRT669090	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT669089	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT669088	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT669087	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT669086	hsa-miR-1976	HITS-CLIP	23824327
MIRT669085	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT736787	hsa-miR-24-3p	Immunohistochemistry (IHC), qRT-PCR	33558874
MIRT669090	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT669089	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT669088	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT669087	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT669086	hsa-miR-1976	HITS-CLIP	23824327
MIRT669085	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT756446	hsa-miR-1200	Luciferase reporter assay	36076262
MIRT882814	hsa-miR-1226	CLIP-seq
MIRT882815	hsa-miR-1293	CLIP-seq
MIRT882816	hsa-miR-1827	CLIP-seq
MIRT882817	hsa-miR-1914	CLIP-seq
MIRT882818	hsa-miR-3192	CLIP-seq
MIRT882819	hsa-miR-3202	CLIP-seq
MIRT882820	hsa-miR-34c-3p	CLIP-seq
MIRT882821	hsa-miR-3612	CLIP-seq
MIRT882822	hsa-miR-3663-5p	CLIP-seq
MIRT882823	hsa-miR-3689a-3p	CLIP-seq
MIRT882824	hsa-miR-3689c	CLIP-seq
MIRT882825	hsa-miR-4314	CLIP-seq
MIRT882826	hsa-miR-4459	CLIP-seq
MIRT882827	hsa-miR-4468	CLIP-seq
MIRT882828	hsa-miR-4483	CLIP-seq
MIRT882829	hsa-miR-4514	CLIP-seq
MIRT882830	hsa-miR-4527	CLIP-seq
MIRT882831	hsa-miR-4646-5p	CLIP-seq
MIRT882832	hsa-miR-4690-5p	CLIP-seq
MIRT882833	hsa-miR-4692	CLIP-seq
MIRT882834	hsa-miR-4695-5p	CLIP-seq
MIRT882835	hsa-miR-4713-5p	CLIP-seq
MIRT882836	hsa-miR-4722-5p	CLIP-seq
MIRT882837	hsa-miR-4728-5p	CLIP-seq
MIRT882838	hsa-miR-4747-5p	CLIP-seq
MIRT882839	hsa-miR-4763-5p	CLIP-seq
MIRT882840	hsa-miR-650	CLIP-seq
MIRT882841	hsa-miR-940	CLIP-seq
MIRT756446	hsa-miR-1200	CLIP-seq
MIRT882823	hsa-miR-3689a-3p	CLIP-seq
MIRT882824	hsa-miR-3689c	CLIP-seq
MIRT1961711	hsa-miR-4324	CLIP-seq
MIRT882837	hsa-miR-4728-5p	CLIP-seq
MIRT1961712	hsa-miR-544b	CLIP-seq
MIRT756446	hsa-miR-1200	CLIP-seq
MIRT882823	hsa-miR-3689a-3p	CLIP-seq
MIRT882824	hsa-miR-3689c	CLIP-seq
MIRT1961711	hsa-miR-4324	CLIP-seq
MIRT882837	hsa-miR-4728-5p	CLIP-seq
MIRT1961712	hsa-miR-544b	CLIP-seq
MIRT756446	hsa-miR-1200	CLIP-seq
MIRT882823	hsa-miR-3689a-3p	CLIP-seq
MIRT882824	hsa-miR-3689c	CLIP-seq
MIRT1961711	hsa-miR-4324	CLIP-seq
MIRT882837	hsa-miR-4728-5p	CLIP-seq
MIRT1961712	hsa-miR-544b	CLIP-seq
MIRT756446	hsa-miR-1200	CLIP-seq
MIRT882823	hsa-miR-3689a-3p	CLIP-seq
MIRT882824	hsa-miR-3689c	CLIP-seq
MIRT1961711	hsa-miR-4324	CLIP-seq
MIRT882837	hsa-miR-4728-5p	CLIP-seq
MIRT1961712	hsa-miR-544b	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
GATA3	Activation	19700764
KLF4	Unknown	23202735
NANOG	Repression	15983365
POU2F1	Unknown	16278805
POU5F1	Repression	17068183

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	15677472
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000794	Component	Condensed nuclear chromosome	IEA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	15677472
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	15677472
GO:0001568	Process	Blood vessel development	IEA
GO:0001824	Process	Blastocyst development	IEA
GO:0001829	Process	Trophectodermal cell differentiation	IEA
GO:0001890	Process	Placenta development	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IBA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	9459001
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0007389	Process	Pattern specification process	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008327	Function	Methyl-CpG binding	IDA	28473536
GO:0008333	Process	Endosome to lysosome transport	IEA
GO:0009880	Process	Embryonic pattern specification	IBA
GO:0009887	Process	Animal organ morphogenesis	TAS	9052785
GO:0009948	Process	Anterior/posterior axis specification	IBA
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0014807	Process	Regulation of somitogenesis	IEA
GO:0014807	Process	Regulation of somitogenesis	ISS
GO:0017053	Component	Transcription repressor complex	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0032991	Component	Protein-containing complex	IEA
GO:0035019	Process	Somatic stem cell population maintenance	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045197	Process	Establishment or maintenance of epithelial cell apical/basal polarity	IEA
GO:0045597	Process	Positive regulation of cell differentiation	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0048565	Process	Digestive tract development	IBA
GO:0048863	Process	Stem cell differentiation	IEA
GO:0060575	Process	Intestinal epithelial cell differentiation	IEA
GO:0060575	Process	Intestinal epithelial cell differentiation	ISS
GO:0060711	Process	Labyrinthine layer development	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 600297
• HGNC: 1806
• e!Ensembl: ENSG00000165556

Protein

• UniProt ID: Q99626
• Protein name: Homeobox protein CDX-2 (CDX-3) (Caudal-type homeobox protein 2)
• Protein function: Transcription factor which regulates the transcription of multiple genes expressed in the intestinal epithelium (By similarity). Binds to the promoter of the intestinal sucrase-isomaltase SI and activates SI transcription (By similarity). Binds
• PDB: 5LTY, 6ES2, 6ES3, 7Q4N
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04731	Caudal_act	13 → 179	Caudal like protein activation region	Family
  PF00046	Homeodomain	187 → 243	Homeodomain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in small intestine, colon and pancreas. {ECO:0000269|PubMed:9933478}.
• Sequence:

  MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQS
  PGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPH
  HHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQ
  VKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAK
  ERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPEPLSPVSSLQASVPGSVPGVL
  GPTGGVLNPTVTQ

• Sequence length: 313

Pathways

KEGG:

Gastric cancer

Reactome:

Synthesis, secretion, and inactivation of Glucagon-like Peptide-1 (GLP-1)

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Sirenomelia	Likely pathogenic	rs1593181774	RCV001003392	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anorectal malformation	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEPTIC ULCER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	22189105, 22547580		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	19158837		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	11733373, 15205684, 15362373, 15722794, 15894926, 16291394, 17549351, 17852856, 18038313, 18156982, 18500171, 18753946		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	12548159, 15894926, 15910596, 15974817, 16027724, 16291394, 16314840, 16361536, 17458588, 17852856, 18665037, 19795349, 21935353, 21950830, 22963903, 23488912, 24489794, 25228975, 27766003, 28029907, 28038793, 28088838, 28226180, 29187465, 29507659, 29556659, 29664741, 29924451, 30001238, 30962505, 31363481, 31417929, 31520753, 31567280		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of ampulla of Vater	Adenocarcinoma	BEFREE	31689805		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	31520753, 9396760		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	15452161, 16291394, 17534889, 19415720, 21935353, 24117650		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	15894926, 16470859, 20514449, 29519711, 29924451		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	12548159, 15141379, 23108025, 26341558, 26469326, 30018118		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	23887294, 26269116		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	BEFREE	16331267		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	15706431, 23425390, 23868178, 29928401, 30229897		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	24976283, 30229897		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	19221108, 20592492, 26361962, 29467879, 31766149		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	10027310, 14625550		★☆☆☆☆ Found in Text Mining only
Adrenomyeloneuropathy	Adrenomyeloneuropathy	BEFREE	28340228		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	19158837		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	19266212		★☆☆☆☆ Found in Text Mining only
ALPHA-THALASSEMIA/MENTAL RETARDATION SYNDROME, NONDELETION TYPE, X-LINKED	alpha-Thalassemia Mental Retardation Syndrome, X-Linked	BEFREE	22240898		★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	36928082	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	24489794, 30662811, 31542399		★☆☆☆☆ Found in Text Mining only
Anus Imperforate	Imperforate anus	Pubtator	34671974	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	30066819, 36839181	Associate	★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	24656654	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	26073892, 27155524, 29581796		★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	31531369		★☆☆☆☆ Found in Text Mining only
Barrett Epithelium	Barrett Epithelium	BEFREE	12560917, 16118348, 16866857		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	12560917, 15452161, 16118348, 16291394, 16866857, 17458588, 17576890, 17852856, 18854960, 19415720, 19449081, 19468668, 19564133, 19789031, 20298175, 20298184, 20303354, 21075347, 21935353, 21950830, 22449796, 23687410, 23918153, 24117650, 26460825, 27729732, 27766003, 27875772, 28807490, 29019984, 31691172		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	LHGDN	14576477, 15167938		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	15167938, 15452161, 18845559, 19468668, 19789031, 20303354, 22016432, 22449796, 23011828, 23382633, 23918153, 25040564, 25412842, 25759548, 26568294, 26926447, 27766003, 28442495, 31691172, 37690144	Associate	★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	23687410	Stimulate	★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	14991752		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	32747898	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18419802, 23821301, 24568506, 25799416, 25849303, 29072133, 30059751, 30212392, 30611858		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18419802, 23982413, 25799416, 25849303	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	15048136, 15645288, 17209848, 22502678, 23317240, 24656654, 30229897, 9593754	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	27384681	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	36510997	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	17090195, 17717663	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10027310, 11733373, 12404231, 12947088, 14525978, 15498792, 15645288, 15825077, 16027724, 19170207, 19795349, 20699370, 22438068, 25228975, 28072391, 28088838, 28226180, 29924451, 30212392		★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	22895825	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	15205684	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	16274362, 34147074	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	11733373	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Medullary	Medullary carcinoma	Pubtator	24437456	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of ampulla of Vater	Ampullary Carcinoma	BEFREE	31689805		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22892849, 28411367, 30389437, 31333781		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	22810971	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	24228110, 24489794	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	16950800		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	18086759, 19223536, 23826116, 25207361, 30250563		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	19158837, 19218548		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	LHGDN	15048136, 16794828		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	15048136, 16794828	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	16794828		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	LHGDN	16996572		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	21221877	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	21653927		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	29228157		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	26229399	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11521200, 11889074, 11997022, 12947088, 12970742, 15013430, 15215241, 16027724, 16314840, 17599044, 18628249, 19584150, 19781065, 19923997, 20514449, 21224344, 21284881, 22189105, 22202456, 23045284, 23958315, 25663763, 27726953, 27816490, 28328000, 28627695, 29519853, 29975781, 30061258, 30214379, 30658608, 30962505		★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	23868178	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	11161380, 16314840		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic neoplasm	Pubtator	11161380, 20699370, 39201360	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	LHGDN	12947088, 15215241, 17599044, 18187048		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic neoplasm	Pubtator	14525978, 14632574, 15205684, 15803184, 15974817, 20044613, 20602288, 21626348, 22268990, 22895825, 26619103, 31584928	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	29439001		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Polyps	Colonic polyps	Pubtator	20699370	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10027310, 10490837, 11161380, 11355940, 12548159, 12947088, 15013430, 15706431, 15732140, 15825077, 15994917, 16361536, 16730885, 17297462, 17534889, 18086783, 18587323, 18628249, 19421714, 19584150, 19686845, 20514449, 20592492, 21660972, 22438068, 22529698, 23112155, 23807779, 24025523, 24075799, 24166180, 24286138, 24615960, 24696747, 24976283, 25131200, 25320087, 25394300, 25663765, 25738688, 26287424, 26307678, 26520418, 27060927, 27220764, 27411517, 27726953, 27729732, 27754705, 28072391, 28226180, 28627695, 28819729, 28914964, 29119016, 29396302, 29467879, 29471325, 29519711, 29675807, 29682204, 29900672, 29924451, 29928401, 30257705, 30326864, 30389437, 30616445, 30716341, 30755502, 30847807, 31318711, 31490234, 31641225, 31772568, 31783700, 9593754, 9704932		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	11161380, 16491830, 17906616, 19686845, 20671195, 24976283, 27470268, 36277982, 9593754	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	11521200, 11566252, 11889074, 12947088, 15389251, 15803184, 15974817, 17922593, 18086783, 18587323, 18628249, 18819935, 19584150, 19781065, 19800103, 20044613, 21284881, 21626348, 22189105, 22268990, 22547830, 22719836, 23807779, 24166180, 25081749, 25663765, 25847407, 26307678, 26619103, 26789870, 26849302, 27060927, 27411517, 28226180, 28328000, 28628609, 29396302, 29900672, 29975781, 30257705, 30326864, 30425348, 30616445, 30658608, 30755502, 30962505, 31474758, 31558874, 31596728, 31641225, 32408894, 32732498, 32737450, 32893845, 32967918, 33341450, 33525395, 33817713, 33823840, 34616012, 34929577, 35051860, 35227453, 35449124, 35785606, 36510997, 36928082, 37164671, 37325467, 37375621, 38155448, 39201360, 39300378, 40142201	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12947088, 15466189, 15619975, 18581275, 18587323		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	16361536, 25131200, 9593754		★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Congenital abnormalities	Pubtator	34671974	Associate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	14625550		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	16794828		★☆☆☆☆ Found in Text Mining only
Congenital myasthenic syndrome ib	Congenital myasthenic syndrome	Pubtator	33721619	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	17957487		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	18045591		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	18045591	Associate	★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	29607487		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	22170372	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	34610433	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	21714463		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	26346470		★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	15782100		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	LHGDN	15547744		★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal ulcer	Pubtator	33608531	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	17468517, 28494767		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	17468517		★☆☆☆☆ Found in Text Mining only
Endometrioid carcinoma ovary	Ovarian endometrioid carcinoma	BEFREE	30326146		★☆☆☆☆ Found in Text Mining only
Enterocolitis	Enterocolitis	BEFREE	11566252		★☆☆☆☆ Found in Text Mining only
Enterocolitis	Enterocolitis	Pubtator	11566252	Inhibit	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	26528998		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	26528998		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	19223536		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	17534889		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	17534889		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	17534889		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	27384681	Associate	★☆☆☆☆ Found in Text Mining only
Esophagitis	Esophagitis	BEFREE	12560917, 19415720		★☆☆☆☆ Found in Text Mining only
Esophagitis	Esotropia	Pubtator	19363439	Associate	★☆☆☆☆ Found in Text Mining only
Esophagitis	Esotropia	Pubtator	23687410	Inhibit	★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	28807490		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	15645288		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	15645288, 21221877	Associate	★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	15732140, 29849798		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	11846061, 29849798		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	24656654, 33282942	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	17209848	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	24175801	Stimulate	★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	LHGDN	11846061		★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	20110706, 23317240, 24175801		★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	27766003	Associate	★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	19251954, 20303354, 23918153, 27766003, 31691172		★☆☆☆☆ Found in Text Mining only
Gastrointestinal carcinoma	Gastrointestinal carcinoma	BEFREE	19584150		★☆☆☆☆ Found in Text Mining only
Gastrointestinal inflammation	Gastrointestinal inflammation	BEFREE	22815676		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	19584150, 20699370, 22895825, 31239549, 39201360	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	28336164		★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	23155691		★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	27435453	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	27435453		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	26526635		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26526635	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26526635		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	26526635	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	31813799		★☆☆☆☆ Found in Text Mining only
Hamartoma	Hamartoma	BEFREE	11355940, 14625550, 17534889		★☆☆☆☆ Found in Text Mining only
Hamartomatous polyposis	Hamartomatous polyposis	BEFREE	19266212		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	31531369		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	21903586	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	30096576		★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	BEFREE	29307626		★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	10027310		★☆☆☆☆ Found in Text Mining only
Hereditary pyropoikilocytosis	Hereditary pyropoikilocytosis	BEFREE	21154739		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	11566252		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	11566252	Inhibit	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	22240898		★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism	Hyperparathyroidism	Pubtator	33306336	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	34610433	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	25847407	Stimulate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	28572085, 31318711		★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	BEFREE	25131200		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	14525978, 14960508, 15167938, 15645288, 15929165, 16951671, 17209848, 17557866, 18684029, 20946664, 21532856, 22449796, 22783055, 23317240, 23382633, 24656654, 25759548, 25867765, 26568294, 28536478, 29215765, 30635407, 31691172, 37240039, 38221567	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	17906616	Inhibit	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	20699370, 30289576	Stimulate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal neoplasm	Pubtator	11161380, 15517368, 20044613, 34563241	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal neoplasm	Pubtator	15929165	Inhibit	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	23393221		★☆☆☆☆ Found in Text Mining only
Intestinal Perforation	Intestinal Perforation	BEFREE	30859181		★☆☆☆☆ Found in Text Mining only
Intestinal Polyposis	Intestinal Polyposis	BEFREE	9230687		★☆☆☆☆ Found in Text Mining only
Intestinal Polyps	Intestinal polyps	Pubtator	12947088	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	15048136, 29698701		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis of Pregnancy	Intrahepatic cholestasis of pregnancy	Pubtator	25171776	Associate	★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	15048136		★☆☆☆☆ Found in Text Mining only
Juvenile polyp	Polyp	BEFREE	19266212		★☆☆☆☆ Found in Text Mining only
Juvenile polyposis syndrome	Polyposis Syndrome	BEFREE	11355940		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	29900672	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	14718672, 20541704, 22547580, 30096576		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	19218548, 33843985, 35192684, 9920852	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	17347684, 19218548, 22189105, 24841154, 9920852	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	14718672, 17347684, 17404613, 17855634, 17881901, 19218548, 20541704, 23202735, 31295506, 31558674		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	17855634		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16274362, 28089540		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	15048136, 16274362, 28089540, 30658608		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	15048136	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	17922593	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	12548159		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	17967182, 22892849	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	15205684, 21221877, 24175801, 27384681	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	16144916, 22783055, 30257705	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	24175801		★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	30096576		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18419802, 23821301, 24568506, 25799416, 25849303, 29072133, 30059751, 30611858		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	28494767		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	17534889		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	15645288, 16794828		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	20699370, 22901255		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22892849, 28411367, 30389437, 31333781		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	18086759, 23826116, 25207361, 30250563		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	15753353, 19106744, 26269116		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	14991752, 17164384, 17440943, 18483391, 21887707, 23868178, 27553621		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	16950800, 25207361		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	10942535, 14557879, 14615935, 16509871, 18254783, 20043087, 20110706, 20527021, 21225631, 21487519, 21532856, 22005013, 22411957, 22563170, 23181722, 23546539, 23864778, 25300947, 25738600, 25881601, 26033320, 26238762, 29113265, 30289576, 31040910		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	14991752, 15974817, 16027724, 16541450, 19415720, 19564133, 19667145, 20110706, 21532856, 23105122, 23317240, 23649760, 24287273, 25207361, 25738688, 26287424, 26789870, 27060927, 27411517, 28862703, 29179508, 30018118, 30636633, 30662811, 31520753, 31596728, 9593754		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	11521200, 11889074, 11997022, 12947088, 15013430, 15215241, 16027724, 16314840, 17599044, 18628249, 19584150, 19781065, 19923997, 20514449, 21224344, 21284881, 22189105, 22202456, 23045284, 25663763, 26789870, 27726953, 27816490, 28328000, 28627695, 29519853, 29975781, 30061258, 30214379, 30658608, 30962505, 9926923		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	29439001		★☆☆☆☆ Found in Text Mining only
Meckel syndrome type 1	Meckel-gruber syndrome	Pubtator	20679295	Associate	★☆☆☆☆ Found in Text Mining only
Medullary carcinoma	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	LHGDN	18992917		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	16950800, 18816636, 25207361, 30944611		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	21836492		★☆☆☆☆ Found in Text Mining only
Mobius Syndrome	Mobius Syndrome	BEFREE	19460469		★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	15087663, 15974817, 20586814		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	19383647		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	9920852		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	31109997		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	29424902	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10490837, 10942535, 12947088, 14500396, 15013430, 15048136, 15316316, 15706431, 15732140, 15848904, 15894926, 15974817, 15994917, 16027724, 16314840, 16361536, 16509871, 16541450, 17255339, 17534889, 17599044, 18992263, 19106744, 19414376, 19584150, 19686845, 19781065, 19795349, 20043087, 20815042, 21224344, 21487519, 21705949, 22083213, 22189105, 22563170, 22824143, 22892849, 22963903, 23112155, 23202735, 23317240, 23488912, 23546539, 23613102, 23864778, 23958547, 24025523, 24166180, 24175801, 24266897, 24286138, 25300947, 25320087, 25738600, 25839701, 26269116, 26341558, 26469326, 26551082, 26789870, 26797858, 27114374, 27411517, 27729732, 27754705, 27816490, 28072391, 28089540, 28328000, 28441375, 28453172, 28463910, 28627695, 28819729, 28862703, 29119016, 29317235, 29489510, 29675807, 29900672, 30087389, 30257705, 30606770, 30662811, 30666415, 30755502, 30859181, 30915540, 30962505, 31140285, 31279332, 31490234, 31542399, 31558674, 9230687, 9593754, 9926923		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	15316316, 15933475, 30456697		★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	35122289	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	18936471, 19414376, 22824143, 28953659, 30018118		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	19960008	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	26346470		★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	25621687	Stimulate	★☆☆☆☆ Found in Text Mining only
Omphalocele exstrophy imperforate anus	Omphalocele exstrophy imperforate anus	Pubtator	34671974	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	21884812		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	16355284		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	16999948, 21115334, 26970179, 29808256		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	23985982, 36980815	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	29343720		★☆☆☆☆ Found in Text Mining only
Ovarian Mucinous Adenocarcinoma	Ovarian adenocarcinoma	BEFREE	27060927, 31659102		★☆☆☆☆ Found in Text Mining only
Ovarian mucinous tumor	Ovarian mucinous tumor	BEFREE	18665037, 28340228		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	18086759, 23826116, 25207361, 30250563		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	15166272, 15205684, 15389251, 15974817, 16980943, 21076463, 27060927, 31659102	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	15048136, 15753353, 19106744, 26269116		★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic Diseases	BEFREE	24489794		★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic diseases	Pubtator	24489794	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	15782100, 24489794		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	19106744		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	15048136, 22268990, 23887294, 25307987, 32925750	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	15517368, 16541450	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	24489794	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	24489794		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	23488912		★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	BEFREE	15452161		★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic ulcer disease	Pubtator	33608531	Associate	★☆☆☆☆ Found in Text Mining only
Persistent cloaca	Persistent cloaca	GENOMICS_ENGLAND_DG	27042391		★☆☆☆☆ Found in Text Mining only
Peutz-Jeghers Syndrome	Peutz-Jeghers Syndrome	BEFREE	11355940		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	15517368	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	26458343		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	26458343, 31089932, 31870342	Associate	★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	19158837		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	19158837		★☆☆☆☆ Found in Text Mining only
Progressive pseudorheumatoid dysplasia	Progressive Pseudorheumatoid Dysplasia	BEFREE	30253739		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	14991752, 17164384, 17440943, 18483391, 21887707, 23868178, 27553621		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21887707, 23868178, 31748757	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	32565880	Associate	★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	18086783		★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	BEFREE	22531171		★☆☆☆☆ Found in Text Mining only
Sacral defect and anterior sacral meningocele	Sacral defect	Pubtator	34671974	Associate	★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	15141379, 18587323, 27726953		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	22895825	Associate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	28322096		★☆☆☆☆ Found in Text Mining only
SHORT STATURE, IDIOPATHIC, X-LINKED	SHORT STATURE, IDIOPATHIC, X-LINKED	BEFREE	24015038		★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	25207361		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	24266897		★☆☆☆☆ Found in Text Mining only
Spondylocostal dysostosis autosomal recessive	Spondylocostal dysostosis	Pubtator	34671974	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	16950800, 17119052, 23105122		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	17342311		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22242137	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	10942535, 16331267, 16509871, 18251778, 18254783, 18996641, 20043087, 20110706, 20527021, 21036460, 21225631, 21487519, 21532856, 22005013, 22104201, 22411957, 22563170, 23181722, 23546539, 23864778, 24283885, 25228975, 25300947, 25738600, 25881601, 26033320, 26238762, 29113265, 30289576, 31040910, 31140285		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	17906616	Inhibit	★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	19363439, 22268990, 34585958	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	14525978, 14615935, 15205684, 15645288, 15929165, 16144916, 16794828, 17209848, 18938748, 21487519, 21532856, 22502678, 22676223, 22783055, 23133598, 24175801, 25300947, 28460480, 29556617, 30289576, 30685841, 31140285, 32704077, 33103284, 33282942, 33639844, 34312322, 34585958, 34884530, 37328804, 37602699, 40149431	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	BEFREE	14557879, 26238762		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	LHGDN	14557879, 14615935, 16509871, 17906616, 18184409, 18254783		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	17906616, 19820687, 25881601	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	27384681	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Teratoma	Teratoma	BEFREE	28322096, 31520753		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	35442371	Associate	★☆☆☆☆ Found in Text Mining only
Timothy syndrome	Timothy Syndrome	BEFREE	23155691		★☆☆☆☆ Found in Text Mining only
Toe Syndactyly Telecanthus and Anogenital and Renal Malformations	Toe syndactyly-telecanthus-anogenital and renal malformations syndrome	Pubtator	34671974	Associate	★☆☆☆☆ Found in Text Mining only
Tricuspid Valve Stenosis	Tricuspid Valve Stenosis	BEFREE	23155691		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	23155691		★☆☆☆☆ Found in Text Mining only
Turcot syndrome	Turcot syndrome	Pubtator	24166180, 26619103, 30962505, 32737450, 37325467	Associate	★☆☆☆☆ Found in Text Mining only
Turcot syndrome (disorder)	Turcot syndrome	BEFREE	24166180, 27813511, 29675807, 30257705		★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner Syndrome	BEFREE	23155691		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	26229399, 27862316		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	BEFREE	27389559		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Diseases	Urinary bladder diseases	Pubtator	16951671	Associate	★☆☆☆☆ Found in Text Mining only
Urogenital Abnormalities	Urogenital abnormalities	Pubtator	34671974, 37816608	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	28786878		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	14632574	Associate	★☆☆☆☆ Found in Text Mining only
VACTERL association	Vacterl association	Pubtator	34671974	Associate	★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	37375621	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	22738935		★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	22738935		★☆☆☆☆ Found in Text Mining only