Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10445
Gene name	Microspherule protein 1
Gene symbol	MCRS1
Synonyms (NCBI Gene)	ICP22BPINO80QMCRS2MSP58P78
Chromosome	12
Chromosome location	12q13.12

Show/Hide all (45)

miRTarBase ID	miRNA	Experiments	Reference
MIRT044730	hsa-miR-320a	CLASH	23622248
MIRT043001	hsa-miR-324-3p	CLASH	23622248
MIRT041247	hsa-miR-193b-3p	CLASH	23622248
MIRT041247	hsa-miR-193b-3p	CLASH	23622248
MIRT739828	hsa-miR-3194-5p	CLIP-seq
MIRT739830	hsa-miR-4719	CLIP-seq
MIRT739829	hsa-miR-4753-5p	CLIP-seq
MIRT739831	hsa-miR-513b	CLIP-seq
MIRT1138054	hsa-miR-1207-3p	CLIP-seq
MIRT1138055	hsa-miR-2467-5p	CLIP-seq
MIRT1138056	hsa-miR-296-3p	CLIP-seq
MIRT1138057	hsa-miR-3135b	CLIP-seq
MIRT1138058	hsa-miR-3180-5p	CLIP-seq
MIRT1138059	hsa-miR-3188	CLIP-seq
MIRT1138060	hsa-miR-3688-5p	CLIP-seq
MIRT1138061	hsa-miR-3975	CLIP-seq
MIRT1138062	hsa-miR-4293	CLIP-seq
MIRT1138063	hsa-miR-4433	CLIP-seq
MIRT1138064	hsa-miR-4649-3p	CLIP-seq
MIRT1138065	hsa-miR-4726-3p	CLIP-seq
MIRT1138066	hsa-miR-485-5p	CLIP-seq
MIRT1138067	hsa-miR-493	CLIP-seq
MIRT1138068	hsa-miR-665	CLIP-seq
MIRT1138054	hsa-miR-1207-3p	CLIP-seq
MIRT2039194	hsa-miR-1207-5p	CLIP-seq
MIRT2039195	hsa-miR-122	CLIP-seq
MIRT2039196	hsa-miR-1303	CLIP-seq
MIRT2039197	hsa-miR-1909	CLIP-seq
MIRT1138056	hsa-miR-296-3p	CLIP-seq
MIRT1138057	hsa-miR-3135b	CLIP-seq
MIRT739828	hsa-miR-3194-5p	CLIP-seq
MIRT2039198	hsa-miR-3652	CLIP-seq
MIRT1138060	hsa-miR-3688-5p	CLIP-seq
MIRT2039199	hsa-miR-4261	CLIP-seq
MIRT2039200	hsa-miR-4430	CLIP-seq
MIRT1138063	hsa-miR-4433	CLIP-seq
MIRT2039201	hsa-miR-4492	CLIP-seq
MIRT2039202	hsa-miR-4498	CLIP-seq
MIRT739830	hsa-miR-4719	CLIP-seq
MIRT2039203	hsa-miR-4736	CLIP-seq
MIRT739829	hsa-miR-4753-5p	CLIP-seq
MIRT2039204	hsa-miR-4763-3p	CLIP-seq
MIRT1138067	hsa-miR-493	CLIP-seq
MIRT739831	hsa-miR-513b	CLIP-seq
MIRT2039205	hsa-miR-762	CLIP-seq

Show/Hide all (63)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000123	Component	Histone acetyltransferase complex	IDA	20018852
GO:0000723	Process	Telomere maintenance	IEA
GO:0000723	Process	Telomere maintenance	ISO
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000776	Component	Kinetochore	IEA
GO:0000922	Component	Spindle pole	IEA
GO:0002151	Function	G-quadruplex RNA binding	IDA	16571602
GO:0002151	Function	G-quadruplex RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	11948183, 15044100, 16189514, 16230350, 16571602, 17014843, 18922472, 19060904, 21303910, 22609355, 25416956, 31515488, 32296183, 32814053, 33961781, 35914814
GO:0005634	Component	Nucleus	IDA	16571602
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS	9765390
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IDA	16571602
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IDA	16571602
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	9765390
GO:0005764	Component	Lysosome	IEA
GO:0005813	Component	Centrosome	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0006275	Process	Regulation of DNA replication	IMP	25016522
GO:0006281	Process	DNA repair	IEA
GO:0006282	Process	Regulation of DNA repair	IEA
GO:0006282	Process	Regulation of DNA repair	ISO
GO:0006310	Process	DNA recombination	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IDA	21303910
GO:0006974	Process	DNA damage response	IEA
GO:0008266	Function	Poly(U) RNA binding	IDA	16571602
GO:0010521	Function	Telomerase inhibitor activity	IDA	15044100
GO:0010604	Process	Positive regulation of macromolecule metabolic process	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS
GO:0031011	Component	Ino80 complex	IDA	21303910
GO:0031011	Component	Ino80 complex	IEA
GO:0032204	Process	Regulation of telomere maintenance	IEA
GO:0033044	Process	Regulation of chromosome organization	IMP	26340092
GO:0034046	Function	Poly(G) binding	IDA	16571602
GO:0034451	Component	Centriolar satellite	IEA
GO:0036211	Process	Protein modification process	TAS	9765390
GO:0043204	Component	Perikaryon	IEA
GO:0043204	Component	Perikaryon	ISS
GO:0044545	Component	NSL complex	IBA
GO:0044545	Component	NSL complex	IDA	20018852
GO:0045739	Process	Positive regulation of DNA repair	IEA
GO:0045739	Process	Positive regulation of DNA repair	ISO
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	27641337
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	24842875
GO:0045935	Process	Positive regulation of nucleobase-containing compound metabolic process	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045995	Process	Regulation of embryonic development	IEA
GO:0045995	Process	Regulation of embryonic development	ISO
GO:0051726	Process	Regulation of cell cycle	IMP	26340092
GO:0060382	Process	Regulation of DNA strand elongation	IMP	25016522
GO:0071339	Component	MLL1 complex	IDA	15960975
GO:0071339	Component	MLL1 complex	IEA
GO:1904357	Process	Negative regulation of telomere maintenance via telomere lengthening	IDA	15044100
GO:1904507	Process	Positive regulation of telomere maintenance in response to DNA damage	IEA
GO:1904507	Process	Positive regulation of telomere maintenance in response to DNA damage	ISO
GO:1904751	Process	Positive regulation of protein localization to nucleolus	IDA	16571602

MIM	HGNC	e!Ensembl
609504	6960	ENSG00000187778

Q96EZ8

Protein name

Microspherule protein 1 (58 kDa microspherule protein) (Cell cycle-regulated factor p78) (INO80 complex subunit J) (MCRS2)

Protein function

Modulates the transcription repressor activity of DAXX by recruiting it to the nucleolus (PubMed:11948183). As part of the NSL complex, may be involved in acetylation of nucleosomal histone H4 on several lysine residues (PubMed:20018852). Putati

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13325	MCRS_N	134 → 331	N-terminal region of micro-spherule protein	Family
PF00498	FHA	363 → 436	FHA domain	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in testis, and at lower levels in spleen, thymus, prostate, uterus, small intestine, colon and leukocytes.

Sequence

MDKDSQGLLDSSLMASGTASRSEDEESLAGQKRASSQALGTIPKRRSSSRFIKRKKFDDE
LVESSLAKSSTRAKGASGVEPGRCSGSEPSSSEKKKVSKAPSTPVPPSPAPAPGLTKRVK
KSKQPLQVTKDLGRWKPADDLLLINAVLQTNDLTSVHLGVKFSCRFTLREVQERWYALLY
DPVISKLACQAMRQLHPEAIAAIQSKALFSKAEEQLLSKVGSTSQPTLETFQDLLHRHPD
AFYLARTAKALQAHWQLMKQYYLLEDQTVQPLPKGDQVLNFSDAEDLIDDSKLKDMRDEV
LEHELMVADRRQKREIRQLEQELHKWQVLVDSITGMSSPDFDNQTLAVLRGRMVRYLMRS
REITLGRATKDNQIDVDLSLEGPAWKISRKQGVIKLKNNGDFFIANEGRRPIYIDGRPVL
CGSKWRLSNNSVVEIASLRFVFLINQDLIALIRAEAAKITPQ

Sequence length

462

Interactions

View interactions

	KEGG		Reactome
	ATP-dependent chromatin remodeling		HATs acetylate histones UCH proteinases DNA Damage Recognition in GG-NER

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (26)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alopecia	Alopecia	BEFREE	10942113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	BEFREE	10942113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19549253	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23225332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	29871630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19549253, 22994740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19549253, 22773039	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26300492, 28448870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	10942113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	22563078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	18798870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	18798870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	18798870, 23996240, 26849376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	26849376	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23519485, 31140612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	30953699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23225332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30953699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23225332, 23519485, 23996240, 26467212, 26849376, 28448870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15659546, 18798870, 19549253, 22563078, 23225332, 23519485, 26467212, 26849376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	22975844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23225332, 25373388, 26467212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26300492, 28448870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	22994740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30953699		★★★★★ ★☆☆☆☆ Found in Text Mining only

MCRS1 (microspherule protein 1)