Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	10439
Gene name	Olfactomedin 1
Gene symbol	OLFM1
Synonyms (NCBI Gene)	AMYNOE1NOELIN1OlfA
Chromosome	9
Chromosome location	9q34.3
Summary	This gene product shares extensive sequence similarity with the rat neuronal olfactomedin-related ER localized protein. While the exact function of the encoded protein is not known, its abundant expression in brain suggests that it may have an essential r

Show/Hide all (83)

miRTarBase ID	miRNA	Experiments	Reference
MIRT733175	hsa-miR-200a-3p	RNA-seqqRT-PCR	33968190
MIRT1203020	hsa-miR-1206	CLIP-seq
MIRT1203021	hsa-miR-1224-5p	CLIP-seq
MIRT1203022	hsa-miR-1271	CLIP-seq
MIRT1203023	hsa-miR-1289	CLIP-seq
MIRT1203024	hsa-miR-132	CLIP-seq
MIRT1203025	hsa-miR-141	CLIP-seq
MIRT1203026	hsa-miR-146a	CLIP-seq
MIRT1203027	hsa-miR-146b-5p	CLIP-seq
MIRT1203028	hsa-miR-182	CLIP-seq
MIRT1203029	hsa-miR-193a-3p	CLIP-seq
MIRT1203030	hsa-miR-193b	CLIP-seq
MIRT1203031	hsa-miR-200a	CLIP-seq
MIRT1203032	hsa-miR-204	CLIP-seq
MIRT1203033	hsa-miR-211	CLIP-seq
MIRT1203034	hsa-miR-2114	CLIP-seq
MIRT1203035	hsa-miR-212	CLIP-seq
MIRT1203036	hsa-miR-27a	CLIP-seq
MIRT1203037	hsa-miR-27b	CLIP-seq
MIRT1203038	hsa-miR-296-5p	CLIP-seq
MIRT1203039	hsa-miR-299-3p	CLIP-seq
MIRT1203040	hsa-miR-3120-3p	CLIP-seq
MIRT1203041	hsa-miR-3121-5p	CLIP-seq
MIRT1203042	hsa-miR-3152-5p	CLIP-seq
MIRT1203043	hsa-miR-329	CLIP-seq
MIRT1203044	hsa-miR-362-3p	CLIP-seq
MIRT1203045	hsa-miR-3679-3p	CLIP-seq
MIRT1203046	hsa-miR-3926	CLIP-seq
MIRT1203047	hsa-miR-3941	CLIP-seq
MIRT1203048	hsa-miR-4256	CLIP-seq
MIRT1203049	hsa-miR-4265	CLIP-seq
MIRT1203050	hsa-miR-4296	CLIP-seq
MIRT1203051	hsa-miR-4317	CLIP-seq
MIRT1203052	hsa-miR-4322	CLIP-seq
MIRT1203053	hsa-miR-4417	CLIP-seq
MIRT1203054	hsa-miR-4423-5p	CLIP-seq
MIRT1203055	hsa-miR-4433	CLIP-seq
MIRT1203056	hsa-miR-4436b-5p	CLIP-seq
MIRT1203057	hsa-miR-4446-5p	CLIP-seq
MIRT1203058	hsa-miR-4477a	CLIP-seq
MIRT1203059	hsa-miR-452	CLIP-seq
MIRT1203060	hsa-miR-4639-3p	CLIP-seq
MIRT1203061	hsa-miR-4670-3p	CLIP-seq
MIRT1203062	hsa-miR-4676-3p	CLIP-seq
MIRT1203063	hsa-miR-4707-5p	CLIP-seq
MIRT1203064	hsa-miR-4709-5p	CLIP-seq
MIRT1203065	hsa-miR-4710	CLIP-seq
MIRT1203066	hsa-miR-4714-5p	CLIP-seq
MIRT1203067	hsa-miR-4724-5p	CLIP-seq
MIRT1203068	hsa-miR-4751	CLIP-seq
MIRT1203069	hsa-miR-4783-3p	CLIP-seq
MIRT1203070	hsa-miR-4792	CLIP-seq
MIRT1203071	hsa-miR-4795-3p	CLIP-seq
MIRT1203072	hsa-miR-513a-5p	CLIP-seq
MIRT1203073	hsa-miR-548aa	CLIP-seq
MIRT1203074	hsa-miR-548ac	CLIP-seq
MIRT1203075	hsa-miR-548d-3p	CLIP-seq
MIRT1203076	hsa-miR-548g	CLIP-seq
MIRT1203077	hsa-miR-548s	CLIP-seq
MIRT1203078	hsa-miR-548z	CLIP-seq
MIRT1203079	hsa-miR-589	CLIP-seq
MIRT1203080	hsa-miR-591	CLIP-seq
MIRT1203081	hsa-miR-593	CLIP-seq
MIRT1203082	hsa-miR-603	CLIP-seq
MIRT1203083	hsa-miR-616	CLIP-seq
MIRT1203084	hsa-miR-629	CLIP-seq
MIRT1203085	hsa-miR-654-3p	CLIP-seq
MIRT1203086	hsa-miR-718	CLIP-seq
MIRT1203087	hsa-miR-885-3p	CLIP-seq
MIRT1203088	hsa-miR-891b	CLIP-seq
MIRT1203089	hsa-miR-96	CLIP-seq
MIRT1203024	hsa-miR-132	CLIP-seq
MIRT1203025	hsa-miR-141	CLIP-seq
MIRT1203031	hsa-miR-200a	CLIP-seq
MIRT1203035	hsa-miR-212	CLIP-seq
MIRT1203022	hsa-miR-1271	CLIP-seq
MIRT1203028	hsa-miR-182	CLIP-seq
MIRT1203036	hsa-miR-27a	CLIP-seq
MIRT1203037	hsa-miR-27b	CLIP-seq
MIRT1203055	hsa-miR-4433	CLIP-seq
MIRT1203072	hsa-miR-513a-5p	CLIP-seq
MIRT1203087	hsa-miR-885-3p	CLIP-seq
MIRT1203089	hsa-miR-96	CLIP-seq

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003190	Process	Atrioventricular valve formation	ISS
GO:0005515	Function	Protein binding	IPI	17043677, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	ISS
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0007165	Process	Signal transduction	IBA
GO:0007399	Process	Nervous system development	TAS	9039501
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010629	Process	Negative regulation of gene expression	ISS
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	ISS
GO:0023041	Process	Neuronal signal transduction	ISS
GO:0030424	Component	Axon	IEA
GO:0030424	Component	Axon	ISS
GO:0030516	Process	Regulation of axon extension	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043025	Component	Neuronal cell body	ISS
GO:0043065	Process	Positive regulation of apoptotic process	IDA	16751333
GO:0043204	Component	Perikaryon	IEA
GO:0044295	Component	Axonal growth cone	ISS
GO:0045202	Component	Synapse	IEA
GO:0060317	Process	Cardiac epithelial to mesenchymal transition	ISS
GO:0098696	Process	Regulation of neurotransmitter receptor localization to postsynaptic specialization membrane	IEA

MIM	HGNC	e!Ensembl
605366	17187	ENSG00000130558

Q99784

Protein name

Noelin (Neuronal olfactomedin-related ER localized protein) (Olfactomedin-1)

Protein function

Contributes to the regulation of axonal growth in the embryonic and adult central nervous system by inhibiting interactions between RTN4R and LINGO1. Inhibits RTN4R-mediated axon growth cone collapse (By similarity). May play an important role i

PDB

4XAT , 6QHJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12308	Noelin-1	54 → 153	Neurogenesis glycoprotein	Family
PF02191	OLF	230 → 476	Olfactomedin-like domain	Family

Sequence

MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTKLSAAGGGTLDRSTGVLPTNPEESW
QVYSSAQDSEGRCICTVVAPQQTMCSRDARTKQLRQLLEKVQNMSQSIEVLDRRTQRDLQ
YVEKMENQMKGLESKFKQVEESHKQHLARQFKAIKAKMDELRPLIPVLEEYKADAKLVLQ
FKEEVQNLTSVLNELQEEIGAYDYDELQSRVSNLEERLRACMQKLACGKLTGISDPVTVK
TSGSRFGSWMTDPLAPEGDNRVWYMDGYHNNRFVREYKSMVDFMNTDNFTSHRLPHPWSG
TGQVVYNGSIYFNKFQSHIIIRFDLKTETILKTRSLDYAGYNNMYHYAWGGHSDIDLMVD
ESGLWAVYATNQNAGNIVVSRLDPVSLQTLQTWNTSYPKRSAGEAFIICGTLYVTNGYSG
GTKVHYAYQTNASTYEYIDIPFQNKYSHISMLDYNPKDRALYAWNNGHQILYNVTLFHVI
RSDEL

Sequence length

485

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (17)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (22)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute pancreatitis	Pancreatitis	BEFREE	29441717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	29615111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	29241710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27555280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	29615111		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Disorder of eye	Disorder Of Eye	BEFREE	15123989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	10393833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	25025207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	25595337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12104089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	12104089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	19208208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrosis	Nephrosis	BEFREE	20595200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	20595200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	35538114	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29191090		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Periodontitis	Periodontitis	BEFREE	28879212, 30111112, 30915073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Phenylketonurias	Phenylketonuria	BEFREE	293128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	29615111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	19208208		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	25025207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	25025207	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

OLFM1 (olfactomedin 1)