Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10438
Gene name	C1D nuclear receptor corepressor
Gene symbol	C1D
Synonyms (NCBI Gene)	LRP1Rrp47SUN-CoRSUNCORhC1D
Chromosome	2
Chromosome location	2p14
Summary	The protein encoded by this gene is a DNA binding and apoptosis-inducing protein and is localized in the nucleus. It is also a Rac3-interacting protein which acts as a corepressor for the thyroid hormone receptor. This protein is thought to regulate TRAX/

215

Show/Hide all (215)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005157	hsa-miR-30a-5p	pSILAC	18668040
MIRT004148	hsa-miR-192-5p	Microarray	16822819
MIRT024488	hsa-miR-215-5p	Microarray	19074876
MIRT004148	hsa-miR-192-5p	Microarray	19074876
MIRT005157	hsa-miR-30a-5p	Proteomics;Other	18668040
MIRT029668	hsa-miR-26b-5p	Microarray	19088304
MIRT724804	hsa-miR-3714	HITS-CLIP	19536157
MIRT724803	hsa-miR-345-3p	HITS-CLIP	19536157
MIRT724802	hsa-miR-4732-3p	HITS-CLIP	19536157
MIRT724801	hsa-miR-125a-5p	HITS-CLIP	19536157
MIRT724800	hsa-miR-125b-5p	HITS-CLIP	19536157
MIRT724799	hsa-miR-4319	HITS-CLIP	19536157
MIRT724798	hsa-miR-6752-3p	HITS-CLIP	19536157
MIRT724797	hsa-miR-6747-3p	HITS-CLIP	19536157
MIRT724796	hsa-miR-4421	HITS-CLIP	19536157
MIRT724795	hsa-miR-5699-3p	HITS-CLIP	19536157
MIRT724794	hsa-miR-4469	HITS-CLIP	19536157
MIRT724793	hsa-miR-7113-3p	HITS-CLIP	19536157
MIRT724792	hsa-miR-4287	HITS-CLIP	19536157
MIRT724791	hsa-miR-4685-3p	HITS-CLIP	19536157
MIRT724790	hsa-miR-605-3p	HITS-CLIP	19536157
MIRT724789	hsa-miR-4493	HITS-CLIP	19536157
MIRT724788	hsa-miR-4290	HITS-CLIP	19536157
MIRT724787	hsa-miR-214-5p	HITS-CLIP	19536157
MIRT724786	hsa-miR-6811-3p	HITS-CLIP	19536157
MIRT724785	hsa-miR-670-5p	HITS-CLIP	19536157
MIRT724784	hsa-miR-6867-3p	HITS-CLIP	19536157
MIRT724783	hsa-miR-6126	HITS-CLIP	19536157
MIRT724782	hsa-miR-6514-3p	HITS-CLIP	19536157
MIRT650391	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT650390	hsa-miR-4258	HITS-CLIP	23824327
MIRT650389	hsa-miR-7108-3p	HITS-CLIP	23824327
MIRT491410	hsa-miR-1915-3p	PAR-CLIP	23592263
MIRT491409	hsa-miR-6764-5p	PAR-CLIP	23592263
MIRT491408	hsa-miR-212-5p	PAR-CLIP	23592263
MIRT491407	hsa-miR-3189-3p	PAR-CLIP	23592263
MIRT491406	hsa-miR-485-5p	PAR-CLIP	23592263
MIRT491405	hsa-miR-6884-5p	PAR-CLIP	23592263
MIRT491404	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT491403	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT491401	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT491402	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT491400	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT491399	hsa-miR-2355-5p	PAR-CLIP	23592263
MIRT449815	hsa-miR-6500-3p	PAR-CLIP	22100165
MIRT449814	hsa-miR-643	PAR-CLIP	22100165
MIRT449813	hsa-miR-567	PAR-CLIP	22100165
MIRT449812	hsa-miR-675-3p	PAR-CLIP	22100165
MIRT449811	hsa-miR-297	PAR-CLIP	22100165
MIRT449810	hsa-miR-3149	PAR-CLIP	22100165
MIRT724804	hsa-miR-3714	HITS-CLIP	19536157
MIRT724803	hsa-miR-345-3p	HITS-CLIP	19536157
MIRT724802	hsa-miR-4732-3p	HITS-CLIP	19536157
MIRT724801	hsa-miR-125a-5p	HITS-CLIP	19536157
MIRT724800	hsa-miR-125b-5p	HITS-CLIP	19536157
MIRT724799	hsa-miR-4319	HITS-CLIP	19536157
MIRT724798	hsa-miR-6752-3p	HITS-CLIP	19536157
MIRT724797	hsa-miR-6747-3p	HITS-CLIP	19536157
MIRT724796	hsa-miR-4421	HITS-CLIP	19536157
MIRT724795	hsa-miR-5699-3p	HITS-CLIP	19536157
MIRT724794	hsa-miR-4469	HITS-CLIP	19536157
MIRT724793	hsa-miR-7113-3p	HITS-CLIP	19536157
MIRT724792	hsa-miR-4287	HITS-CLIP	19536157
MIRT724791	hsa-miR-4685-3p	HITS-CLIP	19536157
MIRT724790	hsa-miR-605-3p	HITS-CLIP	19536157
MIRT724789	hsa-miR-4493	HITS-CLIP	19536157
MIRT724788	hsa-miR-4290	HITS-CLIP	19536157
MIRT724787	hsa-miR-214-5p	HITS-CLIP	19536157
MIRT724786	hsa-miR-6811-3p	HITS-CLIP	19536157
MIRT724785	hsa-miR-670-5p	HITS-CLIP	19536157
MIRT724784	hsa-miR-6867-3p	HITS-CLIP	19536157
MIRT724783	hsa-miR-6126	HITS-CLIP	19536157
MIRT724782	hsa-miR-6514-3p	HITS-CLIP	19536157
MIRT650391	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT650390	hsa-miR-4258	HITS-CLIP	23824327
MIRT650389	hsa-miR-7108-3p	HITS-CLIP	23824327
MIRT491410	hsa-miR-1915-3p	PAR-CLIP	23592263
MIRT491409	hsa-miR-6764-5p	PAR-CLIP	23592263
MIRT491408	hsa-miR-212-5p	PAR-CLIP	23592263
MIRT491407	hsa-miR-3189-3p	PAR-CLIP	23592263
MIRT491406	hsa-miR-485-5p	PAR-CLIP	23592263
MIRT491405	hsa-miR-6884-5p	PAR-CLIP	23592263
MIRT491404	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT491403	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT491401	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT491402	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT491400	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT491399	hsa-miR-2355-5p	PAR-CLIP	23592263
MIRT449815	hsa-miR-6500-3p	PAR-CLIP	22100165
MIRT449814	hsa-miR-643	PAR-CLIP	22100165
MIRT449813	hsa-miR-567	PAR-CLIP	22100165
MIRT449812	hsa-miR-675-3p	PAR-CLIP	22100165
MIRT449811	hsa-miR-297	PAR-CLIP	22100165
MIRT449810	hsa-miR-3149	PAR-CLIP	22100165
MIRT839079	hsa-miR-142-5p	CLIP-seq
MIRT839080	hsa-miR-146b-3p	CLIP-seq
MIRT839081	hsa-miR-186	CLIP-seq
MIRT839082	hsa-miR-192	CLIP-seq
MIRT839083	hsa-miR-215	CLIP-seq
MIRT839084	hsa-miR-27a	CLIP-seq
MIRT839085	hsa-miR-27b	CLIP-seq
MIRT839086	hsa-miR-3064-3p	CLIP-seq
MIRT839087	hsa-miR-3133	CLIP-seq
MIRT839088	hsa-miR-3157-3p	CLIP-seq
MIRT839089	hsa-miR-3163	CLIP-seq
MIRT839090	hsa-miR-3173-5p	CLIP-seq
MIRT839091	hsa-miR-3200-3p	CLIP-seq
MIRT839092	hsa-miR-340	CLIP-seq
MIRT839093	hsa-miR-3662	CLIP-seq
MIRT839094	hsa-miR-410	CLIP-seq
MIRT839095	hsa-miR-450a	CLIP-seq
MIRT839096	hsa-miR-4722-3p	CLIP-seq
MIRT839097	hsa-miR-513a-3p	CLIP-seq
MIRT839098	hsa-miR-513a-5p	CLIP-seq
MIRT839099	hsa-miR-520d-5p	CLIP-seq
MIRT839100	hsa-miR-522	CLIP-seq
MIRT839101	hsa-miR-524-5p	CLIP-seq
MIRT839102	hsa-miR-625	CLIP-seq
MIRT839103	hsa-miR-744	CLIP-seq
MIRT839104	hsa-miR-874	CLIP-seq
MIRT839105	hsa-miR-944	CLIP-seq
MIRT839079	hsa-miR-142-5p	CLIP-seq
MIRT839081	hsa-miR-186	CLIP-seq
MIRT839082	hsa-miR-192	CLIP-seq
MIRT839083	hsa-miR-215	CLIP-seq
MIRT839084	hsa-miR-27a	CLIP-seq
MIRT839085	hsa-miR-27b	CLIP-seq
MIRT839087	hsa-miR-3133	CLIP-seq
MIRT839106	hsa-miR-3177-5p	CLIP-seq
MIRT839092	hsa-miR-340	CLIP-seq
MIRT839107	hsa-miR-3606	CLIP-seq
MIRT839094	hsa-miR-410	CLIP-seq
MIRT839108	hsa-miR-4699-3p	CLIP-seq
MIRT839109	hsa-miR-487a	CLIP-seq
MIRT839097	hsa-miR-513a-3p	CLIP-seq
MIRT839098	hsa-miR-513a-5p	CLIP-seq
MIRT839110	hsa-miR-548l	CLIP-seq
MIRT839111	hsa-miR-570	CLIP-seq
MIRT839102	hsa-miR-625	CLIP-seq
MIRT839103	hsa-miR-744	CLIP-seq
MIRT839112	hsa-miR-889	CLIP-seq
MIRT1948792	hsa-miR-1257	CLIP-seq
MIRT839079	hsa-miR-142-5p	CLIP-seq
MIRT839082	hsa-miR-192	CLIP-seq
MIRT839083	hsa-miR-215	CLIP-seq
MIRT839084	hsa-miR-27a	CLIP-seq
MIRT839085	hsa-miR-27b	CLIP-seq
MIRT839087	hsa-miR-3133	CLIP-seq
MIRT839089	hsa-miR-3163	CLIP-seq
MIRT839092	hsa-miR-340	CLIP-seq
MIRT839093	hsa-miR-3662	CLIP-seq
MIRT839094	hsa-miR-410	CLIP-seq
MIRT1948793	hsa-miR-4318	CLIP-seq
MIRT1948794	hsa-miR-4499	CLIP-seq
MIRT839095	hsa-miR-450a	CLIP-seq
MIRT1948795	hsa-miR-4513	CLIP-seq
MIRT1948796	hsa-miR-4693-5p	CLIP-seq
MIRT1948797	hsa-miR-4696	CLIP-seq
MIRT839108	hsa-miR-4699-3p	CLIP-seq
MIRT839097	hsa-miR-513a-3p	CLIP-seq
MIRT839098	hsa-miR-513a-5p	CLIP-seq
MIRT839100	hsa-miR-522	CLIP-seq
MIRT839110	hsa-miR-548l	CLIP-seq
MIRT839102	hsa-miR-625	CLIP-seq
MIRT839103	hsa-miR-744	CLIP-seq
MIRT1948798	hsa-miR-892a	CLIP-seq
MIRT839079	hsa-miR-142-5p	CLIP-seq
MIRT839095	hsa-miR-450a	CLIP-seq
MIRT839102	hsa-miR-625	CLIP-seq
MIRT839103	hsa-miR-744	CLIP-seq
MIRT839095	hsa-miR-450a	CLIP-seq
MIRT839102	hsa-miR-625	CLIP-seq
MIRT839103	hsa-miR-744	CLIP-seq
MIRT839102	hsa-miR-625	CLIP-seq
MIRT839103	hsa-miR-744	CLIP-seq
MIRT2490655	hsa-miR-1270	CLIP-seq
MIRT2490656	hsa-miR-1273f	CLIP-seq
MIRT839079	hsa-miR-142-5p	CLIP-seq
MIRT2490657	hsa-miR-148a	CLIP-seq
MIRT2490658	hsa-miR-148b	CLIP-seq
MIRT2490659	hsa-miR-152	CLIP-seq
MIRT2490660	hsa-miR-185	CLIP-seq
MIRT839081	hsa-miR-186	CLIP-seq
MIRT839082	hsa-miR-192	CLIP-seq
MIRT839083	hsa-miR-215	CLIP-seq
MIRT2490661	hsa-miR-3074-3p	CLIP-seq
MIRT2490662	hsa-miR-3125	CLIP-seq
MIRT839087	hsa-miR-3133	CLIP-seq
MIRT2490663	hsa-miR-335	CLIP-seq
MIRT839092	hsa-miR-340	CLIP-seq
MIRT2490664	hsa-miR-369-3p	CLIP-seq
MIRT2490665	hsa-miR-374a	CLIP-seq
MIRT2490666	hsa-miR-374b	CLIP-seq
MIRT2490667	hsa-miR-3916	CLIP-seq
MIRT839094	hsa-miR-410	CLIP-seq
MIRT2490668	hsa-miR-4306	CLIP-seq
MIRT2490669	hsa-miR-4531	CLIP-seq
MIRT2490670	hsa-miR-4644	CLIP-seq
MIRT2490671	hsa-miR-4668-3p	CLIP-seq
MIRT839110	hsa-miR-548l	CLIP-seq
MIRT2490672	hsa-miR-620	CLIP-seq
MIRT2490673	hsa-miR-9	CLIP-seq
MIRT2490656	hsa-miR-1273f	CLIP-seq
MIRT839079	hsa-miR-142-5p	CLIP-seq
MIRT2490657	hsa-miR-148a	CLIP-seq
MIRT2490658	hsa-miR-148b	CLIP-seq
MIRT2490659	hsa-miR-152	CLIP-seq
MIRT839081	hsa-miR-186	CLIP-seq
MIRT839082	hsa-miR-192	CLIP-seq
MIRT839083	hsa-miR-215	CLIP-seq
MIRT839087	hsa-miR-3133	CLIP-seq
MIRT2490663	hsa-miR-335	CLIP-seq
MIRT839092	hsa-miR-340	CLIP-seq
MIRT839094	hsa-miR-410	CLIP-seq
MIRT2490671	hsa-miR-4668-3p	CLIP-seq

Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000176	Component	Nuclear exosome (RNase complex)	TAS	17412707
GO:0000178	Component	Exosome (RNase complex)	IBA
GO:0000460	Process	Maturation of 5.8S rRNA	IBA
GO:0000460	Process	Maturation of 5.8S rRNA	IMP	17412707
GO:0003677	Function	DNA binding	IBA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	9469821
GO:0003714	Function	Transcription corepressor activity	IEA
GO:0003723	Function	RNA binding	IBA
GO:0003723	Function	RNA binding	IDA	17412707
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	17412707, 25416956, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	9469821
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IBA
GO:0005730	Component	Nucleolus	IDA
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0006364	Process	RRNA processing	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0010468	Process	Regulation of gene expression	IBA
GO:0016922	Function	Nuclear receptor binding	IEA
GO:0017053	Component	Transcription repressor complex	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA

MIM	HGNC	e!Ensembl
606997	29911	ENSG00000197223

Q13901

Protein name

Nuclear nucleic acid-binding protein C1D (hC1D)

Protein function

Plays a role in the recruitment of the RNA exosome complex to pre-rRNA to mediate the 3'-5' end processing of the 5.8S rRNA; this function may include MPHOSPH6. Can activate PRKDC not only in the presence of linear DNA but also in the presence o

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04000	Sas10_Utp3	17 → 96	Sas10/Utp3/C1D family	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Expressed at very high levels in the hippocampus, medulla oblongata, mammary gland, thyroid and salivary gland. Expressed at high levels in the fetal; lung, liver and kidney. Expressed at low levels in skeletal muscle, appe

Sequence

MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSA
YTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKN
ALWEPKSKNASKVANKGKSKS

Sequence length

141

Interactions

View interactions

	KEGG		Reactome
	RNA degradation		Major pathway of rRNA processing in the nucleolus and cytosol

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Colon adenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (277)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Abdominal Migraine	Abdominal Migraine	CTD_human_DG	21666692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Confusional Migraine	Confusional Migraine	CTD_human_DG	21666692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	31057022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	22664042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	15543372, 19672972, 22037714, 31073076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	11986944, 21114538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	29507659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	GWASCAT_DG	30510241, 31089142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	21325077		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	GWASCAT_DG	29924316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	GWASCAT_DG	30510241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	19672972, 22037714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	11986944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	10404077, 11937269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	10899157, 11461976, 12888553, 12951770, 19664312, 19665999, 21593627, 21676498, 23167255, 24596678, 26856603, 28578378, 34387022, 38067191, 38417436, 9350853, 9837937 View all (2 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	25757756, 33246059	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
ALZHEIMER DISEASE 2	Alzheimer disease	BEFREE	10737120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	10394937, 11076057, 11425005, 24596678, 30741718, 9222170, 9350853, 9637403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	21167913, 28724630, 28938337, 29191087, 31746246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	24054777	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	22055160, 24423473, 25198969, 37893562	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	24054777, 26781079	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	22055160, 22658609, 23478885, 24801553, 24842835, 25198969, 25238221, 26352243, 26781079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	GWASDB_DG	22055160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	GWASCAT_DG	22055160, 27899403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	27569546	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Apraxia, Developmental Verbal	Apraxia	BEFREE	25238221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	12402342, 15288502, 24842835, 25238221, 28301372, 29540796, 29794082, 29914093, 30595089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	26814849	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	21383009		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	17429576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	11479307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	12402342, 15288502, 24842835, 25238221, 28301372, 29540796, 29794082, 29914093, 30595089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	24423473, 24639232, 8182133	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrophoderma vermiculata	Atrophoderma Vermiculata	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrophoderma vermiculatum	Atrophoderma Vermiculata	ORPHANET_DG	26142438		★★★★★ ★☆☆☆☆ Found in Text Mining only
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	22967844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	31094488	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	29545257, 31094488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	31094488	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	26031516, 28561043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	26031516	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bicuspid Aortic Valve Disease	Bicuspid aortic valve	Pubtator	36071494	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	26048454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	8307199	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	38067191	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	29182025, 9832203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Tumor, Primary	Brain Neoplasms	BEFREE	29146996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12793904, 20353938, 24796846, 29107218, 30196236, 30486550, 9367895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12793904, 21299862, 22570085, 37684436	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	34104089	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burnett Schwartz Berberian syndrome	Ulerythema ophryogenesis	BEFREE	26142438, 29545257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burnett Schwartz Berberian syndrome	Ulerythema ophryogenesis	UNIPROT_DG	26142438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burnett Schwartz Berberian syndrome	Ulerythema ophryogenesis	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11006321, 11862483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22427881	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	38615592	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	14597676, 21325077, 23498137, 28662213, 31151274, 9459150, 9713513, 9891461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	36842607	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	19393132, 33828127	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	8879378	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	8879378	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26086967, 27179933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	24423473, 28557183	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	22819221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	22819221, 24639232, 32455133	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	BEFREE	25238221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	27986809	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	Pubtator	18055545	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	26031789, 35241660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	26031789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	32374345	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervical Migraine Syndrome	Migraine	CTD_human_DG	21666692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	15543372, 19672972, 22037714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	11986944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	19968964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choroidal Neovascularization	Choroidal neovascularization	Pubtator	20561980	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	21676498	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	19664312	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29507659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26452133, 29843646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	GWASCAT_DG	30510241, 31089142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17203175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20558745, 25550888, 33172883, 37310025	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	GWASCAT_DG	30510241, 31089142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Comedone	Comedone	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Migraine	Common Migraine	CTD_human_DG	22683712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Migraine	Common Migraine	GWASDB_DG	23793025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Migraine	Common Migraine	GWASCAT_DG	27322543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	11074235, 12402342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	11074235, 12732394, 31247347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	12732394, 28209224, 31247347, 32374345	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Dissection Spontaneous	Spontaneous coronary artery dissection	Pubtator	32374345	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	15121769, 37147786	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	11074235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	30177416	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	23064555, 28235248, 31560818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	21676498, 38067191	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	35241660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	29879253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	23898049	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	20561980, 32455133	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28401370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	12393177	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	29348672, 31700093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	21966368, 23096408, 30902789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	27442082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	10207158	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyggve-Melchior-Clausen syndrome	Dyggve-Melchior-Clausen Disease	BEFREE	23755898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	37147786	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	11006321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	35421980	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	17429576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Episodic Ataxia	Episodic ataxia	Pubtator	38067191	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	32217514, 33311557	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ewings sarcoma	Ewing sarcoma	BEFREE	24129240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Excessive tearing	Excessive Tearing	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial benign pemphigus	Benign Pemphigus	BEFREE	31817098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	27322467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	9852280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Genital ulcers	Genital ulcers	BEFREE	29952395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	19176371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	19176371, 21408136, 7961982	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29182025, 29893017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29182025, 29893017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22027709, 30244167, 30744436, 9832203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	26164207, 34831480, 35862252, 8307199	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	30067725	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	32569156	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Headache	Headache	Pubtator	29397368	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	22965953, 27179933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	30523204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemicrania migraine	Hemicrania Migraine	CTD_human_DG	21666692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	28393618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia a	Pubtator	28393618	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	38615592	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	12837856	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	22819221, 27680891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	15639492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Hyperlipoproteinemia	Pubtator	22819221, 33028190	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	22819221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	29989339, 33566965	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	18281370, 29989339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertriglyceridemia	Hypertriglyceridemia	Pubtator	32115487	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	23517243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	19383717	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21408136	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31023188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	38225283	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	30910704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	14575236, 28401370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	26031789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	28431990	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	LHGDN	12750160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratosis follicularis spinulosa decalvans	Keratosis Follicularis Spinulosa Decalvans	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratosis pilaris	Keratosis pilaris	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratosis pilaris decalvans	Keratosis follicularis spinulosa decalvans	ORPHANET_DG	26142438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	33828127	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	17671794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	18200595	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	18200595, 36781600, 9886324	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	15108169	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	11355932, 11726321, 11986944, 12962366, 15642669, 21114538, 28805931, 31488557, 8630412, 9031075, 9357965, 9473213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	10404077, 11937269, 9778689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukodystrophy, Metachromatic	Metachromatic Leukodystrophy	BEFREE	23701968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukostasis	Leukostasis	BEFREE	27442082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma, Myxoid	liposarcoma	BEFREE	1318779, 2548950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22427881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	21325077, 9891461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21325077, 8879378	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	16645988	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	37310025	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	15161039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	20493228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	PSYGENET_DG	20493228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12793904, 20353938, 24796846, 29107218, 30196236, 30486550, 9367895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	26427016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of large intestine	Colorectal Neoplasms	GWASCAT_DG	30510241, 31089142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21325077, 23498137, 31151274, 9459150, 9713513, 9891461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26086967, 27179933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28899658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20353938, 21480311, 22965953, 27179933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15072883, 15288502, 18387633, 19176371, 20353938, 21415220, 23142051, 24030633, 27179933, 27533246, 28561043, 28662213, 29088295, 29784128, 30140002, 30944251, 8862006 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	29507659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	GWASCAT_DG	30510241, 31089142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	Pubtator	34433325	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12793904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	20826454, 22433869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan Syndrome	BEFREE	23830514, 24484584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan syndrome	Pubtator	24484584	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	17429576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	15498042, 7495278	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21239882, 26790143, 29138479, 29653110, 30458112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	20406964	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	31094488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	29914093, 31538302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	21666692, 22683712, 23294458, 24266335, 24666033, 24852292, 26660531, 29478595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	CTD_human_DG	21666692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	GWASCAT_DG	21666692, 22683712, 23793025, 27182965, 27322543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	GWASDB_DG	21666692, 22683712, 23793025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	21666692, 22683712, 24674449, 24852292, 26660531, 29397368, 39333847	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine with Aura	BEFREE	24852292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine	Pubtator	26660531	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	19664312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya Disease	GWASCAT_DG	29273593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya disease 1	Moyamoya disease	GWASCAT_DG	29273593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	10809991, 19961481, 24030633, 24077352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	16929535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	26762414	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	23334594		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	31488557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	9694437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	29396305	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	23830514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myxoid/Round Cell Liposarcoma	Myxoid Liposarcoma	BEFREE	1318779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	32047813	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	32400857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11268451, 1318779, 19231538, 21239882, 21415220, 23249701, 23633492, 24129240, 25300797, 27179933, 28662213, 29348462, 29507659, 29606888, 30140002 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	11461976	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	16516231, 16609945, 26653549, 28899658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	34696705	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	15288502, 20515747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	11004683, 23178957, 26975633, 27268921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noonan Syndrome	Noonan syndrome	Pubtator	32514133	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	22347399	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28393867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	28235248, 31560818	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	31560818	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	31560818	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	22957024, 29507818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	22957024	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	25300797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	25300797, 25418192	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26086967, 27179933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34995016	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28899658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	30902418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	35628341	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	10495048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	21907175, 25556233	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	30902789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	30902789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	29545257, 31094488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	17429576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	28424481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	29260446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	15543372, 31073076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	29550924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	28576849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20353938, 21480311, 22965953, 27179933, 8610058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	26868746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31023188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	18231792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rudiger syndrome 1	Rudiger syndrome	BEFREE	23355676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	CTD_human_DG	21743468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	31094488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	31094488	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	18855584, 31132459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	17671723, 21415220, 22085272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28662213	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28662213, 29348462, 29416738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Migrainosus	Status Migrainosus	CTD_human_DG	21666692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	27322467, 28301372, 29752404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	36430456	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	26031789	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	18972317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	30904818, 37733241	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	29108253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	16807059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	29088295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30419363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	20493228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	PSYGENET_DG	20493228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34819038, 36030212, 37153545	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	17155964	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

C1D (C1D nuclear receptor corepressor)