PRMT5 (protein arginine methyltransferase 5)

Gene

• Entrez ID: 10419
• Gene name: Protein arginine methyltransferase 5
• Gene symbol: PRMT5
• Synonyms (NCBI Gene): HRMT1L5, HSL7, IBP72, JBP1, SKB1, SKB1Hs
• Chromosome: 14
• Chromosome location: 14q11.2
• Summary: This gene encodes an enzyme that belongs to the methyltransferase family. The encoded protein catalyzes the transfer of methyl groups to the amino acid arginine, in target proteins that include histones, transcriptional elongation factors and the tumor su

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004350	hsa-miR-19a-3p	Western blot	18694959
MIRT000983	hsa-miR-25-3p	Western blot	18694959
MIRT000982	hsa-miR-32-5p	Western blot	18694959
MIRT004351	hsa-miR-92b-3p	Western blot	18694959
MIRT004352	hsa-miR-96-5p	Western blot	18694959
MIRT004350	hsa-miR-19a-3p	Western blot	18694959
MIRT000983	hsa-miR-25-3p	Western blot	18694959
MIRT000982	hsa-miR-32-5p	Western blot	18694959
MIRT044499	hsa-miR-320a	CLASH	23622248
MIRT042720	hsa-miR-346	CLASH	23622248
MIRT004352	hsa-miR-96-5p	Microarray, qRT-PCR	35816043
MIRT1264628	hsa-miR-188-5p	CLIP-seq
MIRT1264629	hsa-miR-374a	CLIP-seq
MIRT1264630	hsa-miR-374b	CLIP-seq
MIRT1264631	hsa-miR-4780	CLIP-seq
MIRT1264632	hsa-miR-623	CLIP-seq
MIRT1264633	hsa-miR-944	CLIP-seq
MIRT1264634	hsa-miR-1237	CLIP-seq
MIRT1264635	hsa-miR-217	CLIP-seq
MIRT1264636	hsa-miR-3130-3p	CLIP-seq
MIRT1264637	hsa-miR-3182	CLIP-seq
MIRT1264638	hsa-miR-3647-3p	CLIP-seq
MIRT1264639	hsa-miR-3686	CLIP-seq
MIRT1264640	hsa-miR-3929	CLIP-seq
MIRT1264641	hsa-miR-4418	CLIP-seq
MIRT1264642	hsa-miR-4419b	CLIP-seq
MIRT1264643	hsa-miR-4478	CLIP-seq
MIRT1264644	hsa-miR-4668-3p	CLIP-seq
MIRT1264645	hsa-miR-4773	CLIP-seq
MIRT1264646	hsa-miR-509-3-5p	CLIP-seq
MIRT1264647	hsa-miR-509-5p	CLIP-seq
MIRT1264648	hsa-miR-576-3p	CLIP-seq
MIRT2457201	hsa-miR-127-5p	CLIP-seq
MIRT2457202	hsa-miR-4468	CLIP-seq
MIRT2457203	hsa-miR-4700-3p	CLIP-seq
MIRT2601223	hsa-miR-1266	CLIP-seq
MIRT2601224	hsa-miR-1304	CLIP-seq
MIRT2601225	hsa-miR-1323	CLIP-seq
MIRT2601226	hsa-miR-2117	CLIP-seq
MIRT2601227	hsa-miR-2467-5p	CLIP-seq
MIRT2601228	hsa-miR-3188	CLIP-seq
MIRT2601229	hsa-miR-338-3p	CLIP-seq
MIRT1264638	hsa-miR-3647-3p	CLIP-seq
MIRT2601230	hsa-miR-3664-3p	CLIP-seq
MIRT2601231	hsa-miR-3671	CLIP-seq
MIRT1264640	hsa-miR-3929	CLIP-seq
MIRT2601232	hsa-miR-3941	CLIP-seq
MIRT2601233	hsa-miR-3975	CLIP-seq
MIRT2601234	hsa-miR-4270	CLIP-seq
MIRT2601235	hsa-miR-4273	CLIP-seq
MIRT1264642	hsa-miR-4419b	CLIP-seq
MIRT2601236	hsa-miR-4441	CLIP-seq
MIRT1264643	hsa-miR-4478	CLIP-seq
MIRT2601237	hsa-miR-4518	CLIP-seq
MIRT2601238	hsa-miR-4530	CLIP-seq
MIRT2601239	hsa-miR-466	CLIP-seq
MIRT1264644	hsa-miR-4668-3p	CLIP-seq
MIRT2601240	hsa-miR-4672	CLIP-seq
MIRT2601241	hsa-miR-4685-5p	CLIP-seq
MIRT2601242	hsa-miR-4716-5p	CLIP-seq
MIRT2601243	hsa-miR-4731-3p	CLIP-seq
MIRT2601244	hsa-miR-4762-5p	CLIP-seq
MIRT1264645	hsa-miR-4773	CLIP-seq
MIRT2601245	hsa-miR-4801	CLIP-seq
MIRT2601246	hsa-miR-485-5p	CLIP-seq
MIRT2601247	hsa-miR-526b	CLIP-seq
MIRT2601248	hsa-miR-548aa	CLIP-seq
MIRT2601249	hsa-miR-548o	CLIP-seq
MIRT2601250	hsa-miR-607	CLIP-seq
MIRT2601223	hsa-miR-1266	CLIP-seq
MIRT2601224	hsa-miR-1304	CLIP-seq
MIRT2601225	hsa-miR-1323	CLIP-seq
MIRT2601226	hsa-miR-2117	CLIP-seq
MIRT2601227	hsa-miR-2467-5p	CLIP-seq
MIRT2601228	hsa-miR-3188	CLIP-seq
MIRT2601229	hsa-miR-338-3p	CLIP-seq
MIRT1264638	hsa-miR-3647-3p	CLIP-seq
MIRT2601230	hsa-miR-3664-3p	CLIP-seq
MIRT2601231	hsa-miR-3671	CLIP-seq
MIRT1264640	hsa-miR-3929	CLIP-seq
MIRT2601232	hsa-miR-3941	CLIP-seq
MIRT2601233	hsa-miR-3975	CLIP-seq
MIRT2601234	hsa-miR-4270	CLIP-seq
MIRT2601235	hsa-miR-4273	CLIP-seq
MIRT1264642	hsa-miR-4419b	CLIP-seq
MIRT2601236	hsa-miR-4441	CLIP-seq
MIRT1264643	hsa-miR-4478	CLIP-seq
MIRT2601237	hsa-miR-4518	CLIP-seq
MIRT2601238	hsa-miR-4530	CLIP-seq
MIRT2601239	hsa-miR-466	CLIP-seq
MIRT1264644	hsa-miR-4668-3p	CLIP-seq
MIRT2601240	hsa-miR-4672	CLIP-seq
MIRT2601241	hsa-miR-4685-5p	CLIP-seq
MIRT2601242	hsa-miR-4716-5p	CLIP-seq
MIRT2601243	hsa-miR-4731-3p	CLIP-seq
MIRT2601244	hsa-miR-4762-5p	CLIP-seq
MIRT1264645	hsa-miR-4773	CLIP-seq
MIRT2601245	hsa-miR-4801	CLIP-seq
MIRT2601246	hsa-miR-485-5p	CLIP-seq
MIRT2601247	hsa-miR-526b	CLIP-seq
MIRT2601248	hsa-miR-548aa	CLIP-seq
MIRT2601249	hsa-miR-548o	CLIP-seq
MIRT2601250	hsa-miR-607	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000387	Process	Spliceosomal snRNP assembly	IMP	17709427
GO:0000387	Process	Spliceosomal snRNP assembly	NAS	11756452
GO:0000785	Component	Chromatin	IDA	33376131
GO:0002039	Function	P53 binding	IPI	19011621
GO:0003714	Function	Transcription corepressor activity	ISS
GO:0005515	Function	Protein binding	IPI	11756452, 12577067, 16087681, 18404153, 18984161, 19011621, 19234465, 20133701, 20159986, 20421892, 20810653, 20951943, 21081503, 22269951, 22327218, 22365833, 23071334, 23133559, 23455924, 23892143, 25092918, 25284789, 25852190, 26700805, 26763441, 26912361, 32296183, 32707033, 328
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	21081503
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	18404153
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IDA	22952863
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA	20421892
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	18984161, 21081503
GO:0005829	Component	Cytosol	TAS
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IDA	18404153
GO:0006353	Process	DNA-templated transcription termination	IMP	26700805
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0007088	Process	Regulation of mitotic nuclear division	TAS	9843966
GO:0008168	Function	Methyltransferase activity	IDA	15369763, 19011621
GO:0008168	Function	Methyltransferase activity	IEA
GO:0008327	Function	Methyl-CpG binding	IDA	25284789
GO:0008469	Function	Histone arginine N-methyltransferase activity	IBA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0016274	Function	Protein-arginine N-methyltransferase activity	IDA	20421892, 26554819
GO:0016274	Function	Protein-arginine N-methyltransferase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0018216	Process	Peptidyl-arginine methylation	IMP	17709427
GO:0032259	Process	Methylation	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0032991	Component	Protein-containing complex	IEA
GO:0034709	Component	Methylosome	IDA	11756452, 18984161, 25284789
GO:0035097	Component	Histone methyltransferase complex	IDA	23048031
GO:0035097	Component	Histone methyltransferase complex	IEA
GO:0035243	Function	Protein-arginine omega-N symmetric methyltransferase activity	EXP	19011621
GO:0035243	Function	Protein-arginine omega-N symmetric methyltransferase activity	IDA	22143770
GO:0035243	Function	Protein-arginine omega-N symmetric methyltransferase activity	IEA
GO:0035243	Function	Protein-arginine omega-N symmetric methyltransferase activity	IMP	17709427
GO:0035246	Process	Peptidyl-arginine N-methylation	IDA	15369763
GO:0042054	Function	Histone methyltransferase activity	TAS
GO:0042118	Process	Endothelial cell activation	IMP	22269951
GO:0042802	Function	Identical protein binding	IPI	11756452, 22365833, 23071334
GO:0043021	Function	Ribonucleoprotein complex binding	IPI	17709427
GO:0044020	Function	Histone H4R3 methyltransferase activity	IDA	18404153, 22143770
GO:0044020	Function	Histone H4R3 methyltransferase activity	IEA
GO:0044020	Function	Histone H4R3 methyltransferase activity	IMP	25284789
GO:0044020	Function	Histone H4R3 methyltransferase activity	ISS
GO:0044027	Process	Negative regulation of gene expression via chromosomal CpG island methylation	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045596	Process	Negative regulation of cell differentiation	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0046982	Function	Protein heterodimerization activity	IDA	18495660
GO:0048026	Process	Positive regulation of mRNA splicing, via spliceosome	NAS	11756452
GO:0048511	Process	Rhythmic process	IEA
GO:0048714	Process	Positive regulation of oligodendrocyte differentiation	IEA
GO:0070372	Process	Regulation of ERK1 and ERK2 cascade	IEA
GO:0070888	Function	E-box binding	ISS
GO:0090161	Process	Golgi ribbon formation	IMP	20421892
GO:0097421	Process	Liver regeneration	IEA
GO:0140938	Function	Histone H3 methyltransferase activity	TAS
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	TAS
GO:1904992	Process	Positive regulation of adenylate cyclase-inhibiting dopamine receptor signaling pathway	IGI	26554819

Other IDs

• MIM: 604045
• HGNC: 10894
• e!Ensembl: ENSG00000100462

Protein

• UniProt ID: O14744
• Protein name: Protein arginine N-methyltransferase 5 (PRMT5) (EC 2.1.1.320) (72 kDa ICln-binding protein) (Histone-arginine N-methyltransferase PRMT5) (Jak-binding protein 1) (Shk1 kinase-binding protein 1 homolog) (SKB1 homolog) (SKB1Hs) [Cleaved into: Protein arginin
• Protein function: Arginine methyltransferase that can both catalyze the formation of omega-N monomethylarginine (MMA) and symmetrical dimethylarginine (sDMA), with a preference for the formation of MMA (PubMed:10531356, PubMed:11152681, PubMed:11747828, PubMed:12
• PDB: 4GQB, 4X60, 4X61, 4X63, 5C9Z, 5EMJ, 5EMK, 5EML, 5EMM, 5FA5, 6CKC, 6K1S, 6RLL, 6RLQ, 6UGH, 6UXX, 6UXY, 6V0N, 6V0O, 6V0P, 7BO7, 7BOC, 7KIB, 7KIC, 7KID, 7L1G, 7M05, 7MX7, 7MXA, 7MXC, 7MXG, 7MXN, 7S0U, 7S1P, 7S1Q, 7S1R, 7S1S, 7SER, 7SES, 7U30, 7UOH, 7UY1, 7UYF, 7ZUP, 7ZUQ, 7ZUU, 7ZUY, 7ZV2, 7ZVL, 7ZVU, 8CSG
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF17285	PRMT5_TIM	37 → 290	PRMT5 TIM barrel domain	Domain
  PF05185	PRMT5	295 → 464	PRMT5 arginine-N-methyltransferase	Domain
  PF17286	PRMT5_C	467 → 635	PRMT5 oligomerisation domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:9556550}.
• Sequence:

  MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAK
  NRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLP
  AFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYS
  GEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNK
  KGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELF
  AKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQV
  LMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDM
  REWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKL
  YNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEF
  PVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICV
  RFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL

• Sequence length: 637

Pathways

Reactome:

snRNP Assembly
RMTs methylate histone arginines
Regulation of TP53 Activity through Methylation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
LYMPHOMA, LARGE B-CELL, DIFFUSE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEDULLOBLASTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRIPLE NEGATIVE BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	30257864		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	30635341		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	24775604		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	22708516, 24775604, 27270440		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	26248553		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	26248553		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	30635341		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	31822509		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	31694585		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	26729154, 31765670		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	33788842	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	26086249		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28591716		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	27860244	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	24664369		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	30800128		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	25742700, 30082494, 30604754		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	28669403	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30713476, 31479715		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25704480, 26420673, 27270440, 28977470, 29185119, 29262329, 29721098, 30034588, 30289978, 30392062, 30957988		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21700716, 25704480, 26420673, 27270440, 28381188, 28977470, 30289978, 33462997, 33782401, 36913304, 37400460, 37458145	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36161608	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24326178, 25475372, 34200178, 36878903	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	24326178	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	26248553		★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	18992153	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	33416213	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28074910, 28101581, 36114756, 36232624, 36499164	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30713476, 31479715		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22708516, 22726390, 24326178, 26988096, 29679612, 30461193, 30746248, 31665911		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	23292799	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35979371, 37781030	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	27270440	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23292799		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	35126952	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic Familial	Cardiomyopathy	Pubtator	33788842	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	33788842	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	32887644	Stimulate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	29724292		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	29724292		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	30635341		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	31694585		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	18694959		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	22170482		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28588584		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29749478		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26078354, 26248553, 28591716, 30858358		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32456215, 32985589, 40302325	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	40269778	Stimulate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	25012667		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30446222		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	30704408		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	30704408	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	32121248	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	31123343, 31822509		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	26597461		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	23292799		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	31439820		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	33090401	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	36764215	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	29773653		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	36499164	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24453002, 26563484, 27292259, 28966034, 29106602, 30034588, 30172110, 31473880, 31533041, 31685892		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24664369, 26563484, 31533041, 31685892, 31694585	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24453002, 24664369, 26563484, 27292259, 28966034, 29106602, 30034588, 30172110, 31473880, 31533041, 31685892		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	24664369, 29529599, 30429891, 31114220		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	24664369, 29529599, 38172189	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	28107179		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	37178682	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	25012667		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	29672052		★☆☆☆☆ Found in Text Mining only
Hemoglobinopathies	Hemoglobinopathy	Pubtator	28669403, 30257864	Associate	★☆☆☆☆ Found in Text Mining only
Hemoglobinopathies	Hemoglobinopathy	BEFREE	30257864		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	26420673, 37861290	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	31822509		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	25927346		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	37400960	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	38252663	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	18694959, 28874563, 30184499, 34712735, 35305370, 37148657	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	25582697, 26536822, 27507053, 27643437, 28663579, 28874563, 28945229, 29672052, 30184499, 30605830, 31408619, 31611688		★☆☆☆☆ Found in Text Mining only
Leukemia Lymphoid	Lymphoid leukemia	Pubtator	26729154	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	30184499, 34712735, 35305370, 40057764	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	26536822, 28945229, 31611688		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	31765670		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27708221, 28074910, 28101581, 29441724, 29679004, 29749478, 30127976, 31131056, 31498866		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	24326178, 27480244, 29679612		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24326178, 30736843, 34200178, 35149174, 35766227, 36927233	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	30461193, 31665911, 37400960	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	33090401, 35434944, 36161608, 36927233	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	26729154		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	18694959, 28874563, 30184499, 31822509, 36167829	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	20951943, 24189068, 25582697, 25742700, 28874563, 30034588, 30082494, 30184499, 30605830, 30885941		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	28107179		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	17627275, 28650658, 31822509		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25704480, 26420673, 28977470, 29185119, 29262329, 29721098, 30034588, 30289978, 30392062, 30957988		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22708516, 22726390, 24326178, 26988096, 29679612, 30461193, 30746248, 31665911		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	23292799		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30922330, 31851779		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27480244, 27546619, 31139329, 31378882		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27315569, 28987382, 29802960, 30034588, 31701767		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30713476, 31479715		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17627275, 18694959, 19372584, 25662273, 26912361, 26990556, 27270440, 27714957, 28087667, 28302565, 28397890, 28650658, 28874563, 29076773, 29185119, 29441724, 29870258, 29946150, 30257864, 30282801, 30366617, 30613353, 30885941, 30903920, 30957988, 31131056, 31139329, 31287990, 31408619, 31611688, 31665911, 31701767, 31712395		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	29724292		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	29749478		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	30957988		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	17627275, 28650658, 29870258, 31822509		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	31694585		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medulloblastoma	Medulloblastoma	Pubtator	31694585	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	BEFREE	24850177, 31439820		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	24850177, 29227283, 31439820, 37917641	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	33795785	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	29773653		★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 1	Multiple Endocrine Neoplasia	BEFREE	23580576		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	29158558		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	27643437		★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Myeloproliferative disorder	Pubtator	21316606	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30704408		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	30704408	Inhibit	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	26708443		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18694959, 20951943, 22266372, 22726390, 23292799, 24189068, 24326178, 24453002, 24664369, 24764298, 25582697, 25704480, 26078354, 26248553, 26912361, 27292259, 27315569, 27708221, 28074910, 28107179, 28966034, 29076773, 29679612, 29749478, 29802960, 30127976, 30289978, 30461193, 30713476, 30800128, 30858358, 30922330, 31479715, 31665911, 31694585, 31712395, 31818951, 31822509		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	27292259		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	25475372, 35803962, 38049564	Associate	★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	24326178		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24326178, 29545752, 31479715		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	32887644	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	28302565		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	32023548	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	23292799		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23292799	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	30922330, 31851779		★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	27315569	Associate	★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	30604754		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	30635341		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27480244, 27546619, 31139329, 31378882		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25281873, 31378882, 35624451, 38583010	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	24189068		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	27860244		★☆☆☆☆ Found in Text Mining only
Sarcoma Clear Cell	Sarcoma	Pubtator	36041632	Associate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	18992153	Associate	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	36927233	Associate	★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	26700805		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	28854561		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28107179, 36878903, 37887269	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	28107179		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29773653		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27315569, 28987382, 29802960, 30034588, 31701767		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	15701830		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27315569, 31701767, 32292506	Associate	★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular Neoplasms	BEFREE	17437848		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	37380368	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	BEFREE	28588584		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35434944, 36199122	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	30305293		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	37399609	Associate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	37399609	Associate	★☆☆☆☆ Found in Text Mining only