Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10417
Gene name	Spondin 2
Gene symbol	SPON2
Synonyms (NCBI Gene)	DIL-1DIL1M-SPONDINMINDIN
Chromosome	4
Chromosome location	4p16.3

126

Show/Hide all (126)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021428	hsa-miR-9-5p	Microarray	17612493
MIRT755466	hsa-miR-328-5p	Luciferase reporter assayWestern blottingqRT-PCRImmunoprecipitaion (IP)In situ hybridization	36153414
MIRT1385173	hsa-let-7a	CLIP-seq
MIRT1385174	hsa-let-7b	CLIP-seq
MIRT1385175	hsa-let-7c	CLIP-seq
MIRT1385176	hsa-let-7d	CLIP-seq
MIRT1385177	hsa-let-7e	CLIP-seq
MIRT1385178	hsa-let-7f	CLIP-seq
MIRT1385179	hsa-let-7g	CLIP-seq
MIRT1385180	hsa-let-7i	CLIP-seq
MIRT1385181	hsa-miR-141	CLIP-seq
MIRT1385182	hsa-miR-200a	CLIP-seq
MIRT1385183	hsa-miR-202	CLIP-seq
MIRT1385184	hsa-miR-2276	CLIP-seq
MIRT1385185	hsa-miR-29a	CLIP-seq
MIRT1385186	hsa-miR-29b	CLIP-seq
MIRT1385187	hsa-miR-29c	CLIP-seq
MIRT1385188	hsa-miR-3663-3p	CLIP-seq
MIRT1385189	hsa-miR-3688-3p	CLIP-seq
MIRT1385190	hsa-miR-4261	CLIP-seq
MIRT1385191	hsa-miR-4300	CLIP-seq
MIRT1385192	hsa-miR-4458	CLIP-seq
MIRT1385193	hsa-miR-4500	CLIP-seq
MIRT1385194	hsa-miR-4649-3p	CLIP-seq
MIRT1385195	hsa-miR-4686	CLIP-seq
MIRT1385196	hsa-miR-4733-3p	CLIP-seq
MIRT1385197	hsa-miR-4755-3p	CLIP-seq
MIRT1385198	hsa-miR-4772-3p	CLIP-seq
MIRT1385199	hsa-miR-4802-3p	CLIP-seq
MIRT1385200	hsa-miR-920	CLIP-seq
MIRT1385201	hsa-miR-98	CLIP-seq
MIRT1385202	hsa-miR-1252	CLIP-seq
MIRT1385203	hsa-miR-1976	CLIP-seq
MIRT1385204	hsa-miR-3690	CLIP-seq
MIRT1385205	hsa-miR-4308	CLIP-seq
MIRT2338004	hsa-miR-103a	CLIP-seq
MIRT2338005	hsa-miR-107	CLIP-seq
MIRT2338006	hsa-miR-1184	CLIP-seq
MIRT2338007	hsa-miR-4665-3p	CLIP-seq
MIRT2440767	hsa-miR-148a	CLIP-seq
MIRT2440768	hsa-miR-148b	CLIP-seq
MIRT2440769	hsa-miR-152	CLIP-seq
MIRT2440770	hsa-miR-2467-3p	CLIP-seq
MIRT2440771	hsa-miR-3189-5p	CLIP-seq
MIRT2440772	hsa-miR-3678-3p	CLIP-seq
MIRT2440773	hsa-miR-4276	CLIP-seq
MIRT2440774	hsa-miR-4729	CLIP-seq
MIRT2460456	hsa-miR-1205	CLIP-seq
MIRT2460457	hsa-miR-1286	CLIP-seq
MIRT2460458	hsa-miR-3929	CLIP-seq
MIRT2460459	hsa-miR-4419b	CLIP-seq
MIRT2460460	hsa-miR-4459	CLIP-seq
MIRT2460461	hsa-miR-4478	CLIP-seq
MIRT2460462	hsa-miR-4695-5p	CLIP-seq
MIRT2460463	hsa-miR-4722-5p	CLIP-seq
MIRT2460464	hsa-miR-485-5p	CLIP-seq
MIRT2460465	hsa-miR-765	CLIP-seq
MIRT1385173	hsa-let-7a	CLIP-seq
MIRT1385174	hsa-let-7b	CLIP-seq
MIRT1385175	hsa-let-7c	CLIP-seq
MIRT1385176	hsa-let-7d	CLIP-seq
MIRT1385177	hsa-let-7e	CLIP-seq
MIRT1385178	hsa-let-7f	CLIP-seq
MIRT1385179	hsa-let-7g	CLIP-seq
MIRT1385180	hsa-let-7i	CLIP-seq
MIRT1385183	hsa-miR-202	CLIP-seq
MIRT1385184	hsa-miR-2276	CLIP-seq
MIRT2631604	hsa-miR-24	CLIP-seq
MIRT1385185	hsa-miR-29a	CLIP-seq
MIRT1385186	hsa-miR-29b	CLIP-seq
MIRT1385187	hsa-miR-29c	CLIP-seq
MIRT2631605	hsa-miR-3065-3p	CLIP-seq
MIRT2440771	hsa-miR-3189-5p	CLIP-seq
MIRT1385188	hsa-miR-3663-3p	CLIP-seq
MIRT2631606	hsa-miR-3677-5p	CLIP-seq
MIRT2631607	hsa-miR-4417	CLIP-seq
MIRT2631608	hsa-miR-4437	CLIP-seq
MIRT1385192	hsa-miR-4458	CLIP-seq
MIRT2631609	hsa-miR-4481	CLIP-seq
MIRT1385193	hsa-miR-4500	CLIP-seq
MIRT1385194	hsa-miR-4649-3p	CLIP-seq
MIRT2631610	hsa-miR-4674	CLIP-seq
MIRT1385195	hsa-miR-4686	CLIP-seq
MIRT2631611	hsa-miR-4693-3p	CLIP-seq
MIRT2440774	hsa-miR-4729	CLIP-seq
MIRT1385196	hsa-miR-4733-3p	CLIP-seq
MIRT2631612	hsa-miR-4745-5p	CLIP-seq
MIRT1385198	hsa-miR-4772-3p	CLIP-seq
MIRT2631613	hsa-miR-4787-3p	CLIP-seq
MIRT2631614	hsa-miR-513c	CLIP-seq
MIRT2631615	hsa-miR-514b-5p	CLIP-seq
MIRT2631616	hsa-miR-663b	CLIP-seq
MIRT1385201	hsa-miR-98	CLIP-seq
MIRT1385173	hsa-let-7a	CLIP-seq
MIRT1385174	hsa-let-7b	CLIP-seq
MIRT1385175	hsa-let-7c	CLIP-seq
MIRT1385176	hsa-let-7d	CLIP-seq
MIRT1385177	hsa-let-7e	CLIP-seq
MIRT1385178	hsa-let-7f	CLIP-seq
MIRT1385179	hsa-let-7g	CLIP-seq
MIRT1385180	hsa-let-7i	CLIP-seq
MIRT1385183	hsa-miR-202	CLIP-seq
MIRT2631604	hsa-miR-24	CLIP-seq
MIRT1385185	hsa-miR-29a	CLIP-seq
MIRT1385186	hsa-miR-29b	CLIP-seq
MIRT1385187	hsa-miR-29c	CLIP-seq
MIRT2631605	hsa-miR-3065-3p	CLIP-seq
MIRT2440771	hsa-miR-3189-5p	CLIP-seq
MIRT1385188	hsa-miR-3663-3p	CLIP-seq
MIRT2631606	hsa-miR-3677-5p	CLIP-seq
MIRT2631607	hsa-miR-4417	CLIP-seq
MIRT2631608	hsa-miR-4437	CLIP-seq
MIRT1385192	hsa-miR-4458	CLIP-seq
MIRT2631609	hsa-miR-4481	CLIP-seq
MIRT1385193	hsa-miR-4500	CLIP-seq
MIRT1385194	hsa-miR-4649-3p	CLIP-seq
MIRT2631610	hsa-miR-4674	CLIP-seq
MIRT2631611	hsa-miR-4693-3p	CLIP-seq
MIRT2440774	hsa-miR-4729	CLIP-seq
MIRT1385196	hsa-miR-4733-3p	CLIP-seq
MIRT2631612	hsa-miR-4745-5p	CLIP-seq
MIRT2631613	hsa-miR-4787-3p	CLIP-seq
MIRT2631614	hsa-miR-513c	CLIP-seq
MIRT2631615	hsa-miR-514b-5p	CLIP-seq
MIRT2631616	hsa-miR-663b	CLIP-seq
MIRT1385201	hsa-miR-98	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001530	Function	Lipopolysaccharide binding	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002448	Process	Mast cell mediated immunity	IEA
GO:0003823	Function	Antigen binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 32814053
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IEA
GO:0007155	Process	Cell adhesion	IBA
GO:0007155	Process	Cell adhesion	IEA
GO:0008228	Process	Opsonization	IEA
GO:0031012	Component	Extracellular matrix	IBA
GO:0031012	Component	Extracellular matrix	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0042742	Process	Defense response to bacterium	IEA
GO:0043152	Process	Induction of bacterial agglutination	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050832	Process	Defense response to fungus	IEA
GO:0051607	Process	Defense response to virus	IEA
GO:0060907	Process	Positive regulation of macrophage cytokine production	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA

MIM	HGNC	e!Ensembl
605918	11253	ENSG00000159674

Q9BUD6

Protein name

Spondin-2 (Differentially expressed in cancerous and non-cancerous lung cells 1) (DIL-1) (Mindin)

Protein function

Cell adhesion protein that promotes adhesion and outgrowth of hippocampal embryonic neurons. Binds directly to bacteria and their components and functions as an opsonin for macrophage phagocytosis of bacteria. Essential in the initiation of the

PDB

3D34

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06468	Spond_N	41 → 235	Spondin_N	Domain
PF19028	TSP1_spondin	278 → 330	Spondin-like TSP1 domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in normal lung tissue but not in lung carcinoma cell lines. {ECO:0000269|PubMed:10512675}.

Sequence

MENPSPAAALGKALCALLLATLGAAGQPLGGESICSARALAKYSITFTGKWSQTAFPKQY
PLFRPPAQWSSLLGAAHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEIEAAGEALQSV
HEVFSAPAVPSGTGQTSAELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLCDGDRWREQA
ALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSPSHPANSFYYPRLKALPPIARVT
LVRLRQSPRAFIPPAPVLPSRDNEIVDSASVPETPLDCEVSLWSSWGLCGGHCGRLGTKS
RTRYVRVQPANNGSPCPELEEEAECVPDNCV

Sequence length

331

Interactions

View interactions

	Reactome
			Defective B3GALTL causes Peters-plus syndrome (PpS) O-glycosylation of TSR domain-containing proteins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, BASAL CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (42)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	28938639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	30037838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	33998076	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30037838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	39941136	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	37713832	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	17006932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30318967	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10512675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	32952742	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	30276603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	39941136	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	25945835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25945835, 26686083, 27669439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25945835	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	39941136	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	39941136	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	21098016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	37130106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	30276603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	30276603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	30527359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19903741, 29440144, 30318967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	33998076	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28060752	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	19208208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28121355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28060752, 28772159, 31691494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28060752, 29440144, 30527359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25945835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	25751394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28060752, 29440144, 30318967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	34183385	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28121355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15583692, 19893039	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	19208208		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sjogren's Syndrome	Sjogren syndrome	Pubtator	35589331	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28060752, 28772159, 31691494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28060752, 34183385	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomatitis Aphthous	Aphthous stomatitis	Pubtator	32793186	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	30318967	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33204728	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SPON2 (spondin 2)