YAP1 (Yes1 associated transcriptional regulator)

Gene

• Entrez ID: 10413
• Gene name: Yes1 associated transcriptional regulator
• Gene symbol: YAP1
• Synonyms (NCBI Gene): COB1, YAP, YAP-1, YAP2, YAP65, YKI
• Chromosome: 11
• Chromosome location: 11q22.1
• Summary: This gene encodes a downstream nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis. This gene is known to play a role in the development and progression of multiple cancers as a transcriptional

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs587777249	C>T	Pathogenic	Coding sequence variant, 5 prime UTR variant, stop gained
rs587777250	G>T	Pathogenic	Coding sequence variant, stop gained
rs1591100766	C>G	Likely-pathogenic	5 prime UTR variant, coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005047	hsa-let-7b-5p	Microarray	17699775
MIRT005580	hsa-miR-630	Immunoblot, Luciferase reporter assay, qRT-PCR	21274007
MIRT006154	hsa-miR-375	Luciferase reporter assay, Microarray, qRT-PCR	21856745
MIRT006154	hsa-miR-375	Luciferase reporter assay, Microarray, qRT-PCR	21856745
MIRT006154	hsa-miR-375	Luciferase reporter assay, Microarray, qRT-PCR	21856745
MIRT006154	hsa-miR-375	Luciferase reporter assay, Microarray, qRT-PCR	21856745
MIRT007299	hsa-miR-200a-3p	Western blot	23340296
MIRT007299	hsa-miR-200a-3p	Western blot	23340296
MIRT006154	hsa-miR-375	Microarray	20215506
MIRT030244	hsa-miR-26b-5p	Microarray	19088304
MIRT052906	hsa-miR-141-3p	Luciferase reporter assay, Western blot	24242138
MIRT052906	hsa-miR-141-3p	Luciferase reporter assay, Western blot	24242138
MIRT054283	hsa-miR-15a-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	25743273
MIRT054283	hsa-miR-15a-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	25743273
MIRT054283	hsa-miR-15a-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	25743273
MIRT054283	hsa-miR-15a-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	25743273
MIRT054284	hsa-miR-16-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	25743273
MIRT054284	hsa-miR-16-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	25743273
MIRT054284	hsa-miR-16-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	25743273
MIRT054284	hsa-miR-16-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	25743273
MIRT006154	hsa-miR-375	Luciferase reporter assay, Western blot, qRT-PCR	24892549
MIRT438349	hsa-miR-506-3p	Luciferase reporter assay, qRT-PCR, Western blot	25846731
MIRT438349	hsa-miR-506-3p	Luciferase reporter assay, qRT-PCR, Western blot	25846731
MIRT438349	hsa-miR-506-3p	Luciferase reporter assay, qRT-PCR, Western blot	25846731
MIRT438349	hsa-miR-506-3p	Luciferase reporter assay, qRT-PCR, Western blot	25846731
MIRT697603	hsa-miR-10a-3p	HITS-CLIP	23313552
MIRT697601	hsa-miR-4272	HITS-CLIP	23313552
MIRT697602	hsa-miR-4729	HITS-CLIP	23313552
MIRT697600	hsa-miR-138-2-3p	HITS-CLIP	23313552
MIRT697599	hsa-miR-6844	HITS-CLIP	23313552
MIRT697598	hsa-miR-4639-5p	HITS-CLIP	23313552
MIRT264359	hsa-miR-548a-5p	PAR-CLIP	20371350
MIRT264383	hsa-miR-548ab	PAR-CLIP	20371350
MIRT264384	hsa-miR-548ad-5p	PAR-CLIP	20371350
MIRT264385	hsa-miR-548ae-5p	PAR-CLIP	20371350
MIRT264387	hsa-miR-548ak	PAR-CLIP	20371350
MIRT264388	hsa-miR-548am-5p	PAR-CLIP	20371350
MIRT264389	hsa-miR-548ap-5p	PAR-CLIP	20371350
MIRT264390	hsa-miR-548aq-5p	PAR-CLIP	20371350
MIRT264391	hsa-miR-548ar-5p	PAR-CLIP	20371350
MIRT264392	hsa-miR-548as-5p	PAR-CLIP	20371350
MIRT264393	hsa-miR-548au-5p	PAR-CLIP	20371350
MIRT264396	hsa-miR-548ay-5p	PAR-CLIP	20371350
MIRT264358	hsa-miR-548b-5p	PAR-CLIP	20371350
MIRT264400	hsa-miR-548bb-5p	PAR-CLIP	20371350
MIRT264360	hsa-miR-548c-5p	PAR-CLIP	20371350
MIRT264361	hsa-miR-548d-5p	PAR-CLIP	20371350
MIRT264370	hsa-miR-548h-5p	PAR-CLIP	20371350
MIRT264372	hsa-miR-548i	PAR-CLIP	20371350
MIRT264365	hsa-miR-548j-5p	PAR-CLIP	20371350
MIRT264382	hsa-miR-548o-5p	PAR-CLIP	20371350
MIRT264376	hsa-miR-548w	PAR-CLIP	20371350
MIRT264381	hsa-miR-548y	PAR-CLIP	20371350
MIRT264357	hsa-miR-559	PAR-CLIP	20371350
MIRT264394	hsa-miR-548av-5p	PAR-CLIP	20371350
MIRT264366	hsa-miR-548k	PAR-CLIP	20371350
MIRT264399	hsa-miR-8054	PAR-CLIP	20371350
MIRT264367	hsa-miR-548l	PAR-CLIP	20371350
MIRT264373	hsa-miR-3121-3p	PAR-CLIP	20371350
MIRT264374	hsa-miR-3125	PAR-CLIP	20371350
MIRT264380	hsa-miR-3916	PAR-CLIP	20371350
MIRT264398	hsa-miR-6859-5p	PAR-CLIP	20371350
MIRT264371	hsa-miR-548p	PAR-CLIP	20371350
MIRT264375	hsa-miR-3159	PAR-CLIP	20371350
MIRT264362	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT264364	hsa-miR-877-5p	PAR-CLIP	20371350
MIRT731507	hsa-miR-509-3p	Luciferase reporter assay	27036018
MIRT731507	hsa-miR-509-3p	Luciferase reporter assay	27036018
MIRT006154	hsa-miR-375	Flow, Immunohistochemistry, qRT-PCR, Western blot	27832783
MIRT732285	hsa-miR-27a-3p	Luciferase reporter assay, qRT-PCR, Western blot	27432214
MIRT732285	hsa-miR-27a-3p	Luciferase reporter assay, qRT-PCR, Western blot	27432214
MIRT735431	hsa-miR-195-5p	Luciferase reporter assay, qRT-PCR, Western blot	28356122
MIRT735431	hsa-miR-195-5p	Luciferase reporter assay, qRT-PCR, Western blot	28356122
MIRT735431	hsa-miR-195-5p	Luciferase reporter assay, qRT-PCR, Western blot	28356122
MIRT735431	hsa-miR-195-5p	Luciferase reporter assay, qRT-PCR, Western blot	28356122
MIRT438349	hsa-miR-506-3p	Luciferase reporter assay, Western blot	26550114
MIRT732932	hsa-miR-335-3p	Immunohistochemistry (IHC), Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR, Western blotting	33888871
MIRT733118	hsa-miR-93-3p	Immunofluorescence, Immunohistochemistry (IHC), Microarray, RNA-seq, qRT-PCR	33495462
MIRT733119	hsa-miR-17-3p	Immunofluorescence, Immunohistochemistry (IHC), Microarray, RNA-seq, qRT-PCR	33495462
MIRT733120	hsa-miR-20a-3p	Immunofluorescence, Immunohistochemistry (IHC), Microarray, RNA-seq, qRT-PCR	33495462
MIRT733121	hsa-miR-20b-3p	Immunofluorescence, Immunohistochemistry (IHC), Microarray, RNA-seq, qRT-PCR	33495462
MIRT733122	hsa-miR-106a-3p	Immunofluorescence, Immunohistochemistry (IHC), Microarray, RNA-seq, qRT-PCR	33495462
MIRT733123	hsa-miR-106b-3p	Immunofluorescence, Immunohistochemistry (IHC), Microarray, RNA-seq, qRT-PCR	33495462
MIRT731507	hsa-miR-509-3p	Immunohistochemistry (IHC), RNA-seq, Western blotting	33420363
MIRT731507	hsa-miR-509-3p	Immunohistochemistry (IHC), RNA-seq, Western blotting	33420363
MIRT733357	hsa-miR-509-5p	Immunohistochemistry (IHC), RNA-seq, Western blotting	33420363
MIRT735431	hsa-miR-195-5p	Luciferase reporter assay, Western blotting, qRT-PCR, In situ hybridization	32099397
MIRT697603	hsa-miR-10a-3p	HITS-CLIP	23313552
MIRT697601	hsa-miR-4272	HITS-CLIP	23313552
MIRT697602	hsa-miR-4729	HITS-CLIP	23313552
MIRT697600	hsa-miR-138-2-3p	HITS-CLIP	23313552
MIRT697599	hsa-miR-6844	HITS-CLIP	23313552
MIRT697598	hsa-miR-4639-5p	HITS-CLIP	23313552
MIRT264359	hsa-miR-548a-5p	PAR-CLIP	20371350
MIRT264383	hsa-miR-548ab	PAR-CLIP	20371350
MIRT264384	hsa-miR-548ad-5p	PAR-CLIP	20371350
MIRT264385	hsa-miR-548ae-5p	PAR-CLIP	20371350
MIRT264387	hsa-miR-548ak	PAR-CLIP	20371350
MIRT264388	hsa-miR-548am-5p	PAR-CLIP	20371350
MIRT264389	hsa-miR-548ap-5p	PAR-CLIP	20371350
MIRT264390	hsa-miR-548aq-5p	PAR-CLIP	20371350
MIRT264391	hsa-miR-548ar-5p	PAR-CLIP	20371350
MIRT264392	hsa-miR-548as-5p	PAR-CLIP	20371350
MIRT264393	hsa-miR-548au-5p	PAR-CLIP	20371350
MIRT264396	hsa-miR-548ay-5p	PAR-CLIP	20371350
MIRT264358	hsa-miR-548b-5p	PAR-CLIP	20371350
MIRT264400	hsa-miR-548bb-5p	PAR-CLIP	20371350
MIRT264360	hsa-miR-548c-5p	PAR-CLIP	20371350
MIRT264361	hsa-miR-548d-5p	PAR-CLIP	20371350
MIRT264370	hsa-miR-548h-5p	PAR-CLIP	20371350
MIRT264372	hsa-miR-548i	PAR-CLIP	20371350
MIRT264365	hsa-miR-548j-5p	PAR-CLIP	20371350
MIRT264382	hsa-miR-548o-5p	PAR-CLIP	20371350
MIRT264376	hsa-miR-548w	PAR-CLIP	20371350
MIRT264381	hsa-miR-548y	PAR-CLIP	20371350
MIRT264357	hsa-miR-559	PAR-CLIP	20371350
MIRT264394	hsa-miR-548av-5p	PAR-CLIP	20371350
MIRT264366	hsa-miR-548k	PAR-CLIP	20371350
MIRT264399	hsa-miR-8054	PAR-CLIP	20371350
MIRT264367	hsa-miR-548l	PAR-CLIP	20371350
MIRT264373	hsa-miR-3121-3p	PAR-CLIP	20371350
MIRT264374	hsa-miR-3125	PAR-CLIP	20371350
MIRT264380	hsa-miR-3916	PAR-CLIP	20371350
MIRT264398	hsa-miR-6859-5p	PAR-CLIP	20371350
MIRT264371	hsa-miR-548p	PAR-CLIP	20371350
MIRT264375	hsa-miR-3159	PAR-CLIP	20371350
MIRT264362	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT264364	hsa-miR-877-5p	PAR-CLIP	20371350
MIRT731507	hsa-miR-509-3p	Luciferase reporter assay, Western blotting	34715859
MIRT735431	hsa-miR-195-5p	Luciferase reporter assay, Western blotting, qRT-PCR, in vitro cullelar assays, RNA pull down assay	35819551
MIRT755521	hsa-miR-200c-3p	Flow cytometry, Immunocytochemistry (ICC)	34631284
MIRT756105	hsa-miR-484	Luciferase reporter assay, Western blotting, qRT-PCR	35173533
MIRT756406	hsa-miR-584-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunohistochemistry (IHC)	35358000
MIRT756428	hsa-miR-596	Western blotting, qRT-PCR, Immunofluorescence, ELISA	35961957
MIRT1498035	hsa-miR-101	CLIP-seq
MIRT1498036	hsa-miR-103b	CLIP-seq
MIRT1498037	hsa-miR-1206	CLIP-seq
MIRT1498038	hsa-miR-1227	CLIP-seq
MIRT1498039	hsa-miR-1264	CLIP-seq
MIRT1498040	hsa-miR-1276	CLIP-seq
MIRT1498041	hsa-miR-1278	CLIP-seq
MIRT1498042	hsa-miR-128	CLIP-seq
MIRT1498043	hsa-miR-1305	CLIP-seq
MIRT1498044	hsa-miR-134	CLIP-seq
MIRT1498045	hsa-miR-141	CLIP-seq
MIRT1498046	hsa-miR-142-5p	CLIP-seq
MIRT1498047	hsa-miR-146a	CLIP-seq
MIRT1498048	hsa-miR-146b-5p	CLIP-seq
MIRT1498049	hsa-miR-200a	CLIP-seq
MIRT1498050	hsa-miR-205	CLIP-seq
MIRT1498051	hsa-miR-21	CLIP-seq
MIRT1498052	hsa-miR-2117	CLIP-seq
MIRT1498053	hsa-miR-22	CLIP-seq
MIRT1498054	hsa-miR-221	CLIP-seq
MIRT1498055	hsa-miR-222	CLIP-seq
MIRT1498056	hsa-miR-27a	CLIP-seq
MIRT1498057	hsa-miR-27b	CLIP-seq
MIRT1498058	hsa-miR-3064-3p	CLIP-seq
MIRT1498059	hsa-miR-3118	CLIP-seq
MIRT1498060	hsa-miR-3136-5p	CLIP-seq
MIRT1498061	hsa-miR-3157-5p	CLIP-seq
MIRT1498062	hsa-miR-340	CLIP-seq
MIRT1498063	hsa-miR-346	CLIP-seq
MIRT1498064	hsa-miR-3617	CLIP-seq
MIRT1498065	hsa-miR-3646	CLIP-seq
MIRT1498066	hsa-miR-3662	CLIP-seq
MIRT1498067	hsa-miR-3682-5p	CLIP-seq
MIRT1498068	hsa-miR-376a	CLIP-seq
MIRT1498069	hsa-miR-376b	CLIP-seq
MIRT1498070	hsa-miR-421	CLIP-seq
MIRT1498071	hsa-miR-4252	CLIP-seq
MIRT1498072	hsa-miR-4263	CLIP-seq
MIRT1498073	hsa-miR-4311	CLIP-seq
MIRT1498074	hsa-miR-4424	CLIP-seq
MIRT1498075	hsa-miR-4427	CLIP-seq
MIRT1498076	hsa-miR-4439	CLIP-seq
MIRT1498077	hsa-miR-4452	CLIP-seq
MIRT1498078	hsa-miR-4477a	CLIP-seq
MIRT1498079	hsa-miR-450b-5p	CLIP-seq
MIRT1498080	hsa-miR-4513	CLIP-seq
MIRT1498081	hsa-miR-452	CLIP-seq
MIRT1498082	hsa-miR-4676-3p	CLIP-seq
MIRT1498083	hsa-miR-4680-3p	CLIP-seq
MIRT1498084	hsa-miR-4682	CLIP-seq
MIRT1498085	hsa-miR-4684-5p	CLIP-seq
MIRT1498086	hsa-miR-4693-5p	CLIP-seq
MIRT1498087	hsa-miR-4709-3p	CLIP-seq
MIRT1498088	hsa-miR-4715-3p	CLIP-seq
MIRT1498089	hsa-miR-4727-5p	CLIP-seq
MIRT1498090	hsa-miR-4738-3p	CLIP-seq
MIRT1498091	hsa-miR-4755-3p	CLIP-seq
MIRT1498092	hsa-miR-4760-3p	CLIP-seq
MIRT1498093	hsa-miR-4761-5p	CLIP-seq
MIRT1498094	hsa-miR-4773	CLIP-seq
MIRT1498095	hsa-miR-4786-5p	CLIP-seq
MIRT1498096	hsa-miR-493	CLIP-seq
MIRT1498097	hsa-miR-495	CLIP-seq
MIRT1498098	hsa-miR-496	CLIP-seq
MIRT1498099	hsa-miR-507	CLIP-seq
MIRT1498100	hsa-miR-513a-5p	CLIP-seq
MIRT1498101	hsa-miR-513b	CLIP-seq
MIRT1498102	hsa-miR-520d-5p	CLIP-seq
MIRT1498103	hsa-miR-524-5p	CLIP-seq
MIRT1498104	hsa-miR-544	CLIP-seq
MIRT1498105	hsa-miR-548ag	CLIP-seq
MIRT1498106	hsa-miR-548ai	CLIP-seq
MIRT1498107	hsa-miR-548v	CLIP-seq
MIRT1498108	hsa-miR-557	CLIP-seq
MIRT1498109	hsa-miR-561	CLIP-seq
MIRT1498110	hsa-miR-583	CLIP-seq
MIRT1498111	hsa-miR-589	CLIP-seq
MIRT1498112	hsa-miR-590-5p	CLIP-seq
MIRT1498113	hsa-miR-618	CLIP-seq
MIRT1498114	hsa-miR-622	CLIP-seq
MIRT1498115	hsa-miR-641	CLIP-seq
MIRT1498116	hsa-miR-885-3p	CLIP-seq
MIRT1498117	hsa-let-7a	CLIP-seq
MIRT1498118	hsa-let-7b	CLIP-seq
MIRT1498119	hsa-let-7c	CLIP-seq
MIRT1498120	hsa-let-7d	CLIP-seq
MIRT1498121	hsa-let-7e	CLIP-seq
MIRT1498122	hsa-let-7f	CLIP-seq
MIRT1498123	hsa-let-7g	CLIP-seq
MIRT1498124	hsa-let-7i	CLIP-seq
MIRT1498035	hsa-miR-101	CLIP-seq
MIRT1498036	hsa-miR-103b	CLIP-seq
MIRT1498125	hsa-miR-1184	CLIP-seq
MIRT1498126	hsa-miR-1185	CLIP-seq
MIRT1498127	hsa-miR-1202	CLIP-seq
MIRT1498128	hsa-miR-1205	CLIP-seq
MIRT1498037	hsa-miR-1206	CLIP-seq
MIRT1498038	hsa-miR-1227	CLIP-seq
MIRT1498129	hsa-miR-1245	CLIP-seq
MIRT1498041	hsa-miR-1278	CLIP-seq
MIRT1498042	hsa-miR-128	CLIP-seq
MIRT1498130	hsa-miR-1285	CLIP-seq
MIRT1498131	hsa-miR-1303	CLIP-seq
MIRT1498043	hsa-miR-1305	CLIP-seq
MIRT1498132	hsa-miR-1323	CLIP-seq
MIRT1498045	hsa-miR-141	CLIP-seq
MIRT1498046	hsa-miR-142-5p	CLIP-seq
MIRT1498133	hsa-miR-15a	CLIP-seq
MIRT1498134	hsa-miR-15b	CLIP-seq
MIRT1498135	hsa-miR-16	CLIP-seq
MIRT1498136	hsa-miR-186	CLIP-seq
MIRT1498137	hsa-miR-1912	CLIP-seq
MIRT1498138	hsa-miR-193a-3p	CLIP-seq
MIRT1498139	hsa-miR-193b	CLIP-seq
MIRT1498140	hsa-miR-195	CLIP-seq
MIRT1498049	hsa-miR-200a	CLIP-seq
MIRT1498141	hsa-miR-200b	CLIP-seq
MIRT1498142	hsa-miR-200c	CLIP-seq
MIRT1498143	hsa-miR-202	CLIP-seq
MIRT1498051	hsa-miR-21	CLIP-seq
MIRT1498053	hsa-miR-22	CLIP-seq
MIRT1498054	hsa-miR-221	CLIP-seq
MIRT1498055	hsa-miR-222	CLIP-seq
MIRT1498056	hsa-miR-27a	CLIP-seq
MIRT1498057	hsa-miR-27b	CLIP-seq
MIRT1498144	hsa-miR-300	CLIP-seq
MIRT1498058	hsa-miR-3064-3p	CLIP-seq
MIRT1498145	hsa-miR-3119	CLIP-seq
MIRT1498146	hsa-miR-3128	CLIP-seq
MIRT1498147	hsa-miR-3130-3p	CLIP-seq
MIRT1498148	hsa-miR-3130-5p	CLIP-seq
MIRT1498149	hsa-miR-3133	CLIP-seq
MIRT1498150	hsa-miR-3140-3p	CLIP-seq
MIRT1498151	hsa-miR-3143	CLIP-seq
MIRT1498152	hsa-miR-3155	CLIP-seq
MIRT1498153	hsa-miR-3155b	CLIP-seq
MIRT1498154	hsa-miR-3158-5p	CLIP-seq
MIRT1498155	hsa-miR-3163	CLIP-seq
MIRT1498156	hsa-miR-3180-5p	CLIP-seq
MIRT1498157	hsa-miR-3182	CLIP-seq
MIRT1498158	hsa-miR-3184	CLIP-seq
MIRT1498159	hsa-miR-3187-3p	CLIP-seq
MIRT1498160	hsa-miR-3187-5p	CLIP-seq
MIRT1498161	hsa-miR-320a	CLIP-seq
MIRT1498162	hsa-miR-320b	CLIP-seq
MIRT1498163	hsa-miR-320c	CLIP-seq
MIRT1498164	hsa-miR-320d	CLIP-seq
MIRT1498165	hsa-miR-323-3p	CLIP-seq
MIRT1498166	hsa-miR-330-3p	CLIP-seq
MIRT1498167	hsa-miR-338-5p	CLIP-seq
MIRT1498168	hsa-miR-33a	CLIP-seq
MIRT1498169	hsa-miR-33b	CLIP-seq
MIRT1498062	hsa-miR-340	CLIP-seq
MIRT1498170	hsa-miR-361-3p	CLIP-seq
MIRT1498171	hsa-miR-3622a-3p	CLIP-seq
MIRT1498172	hsa-miR-3622a-5p	CLIP-seq
MIRT1498173	hsa-miR-3622b-3p	CLIP-seq
MIRT1498065	hsa-miR-3646	CLIP-seq
MIRT1498174	hsa-miR-3663-3p	CLIP-seq
MIRT1498175	hsa-miR-3667-3p	CLIP-seq
MIRT1498176	hsa-miR-3677-5p	CLIP-seq
MIRT1498177	hsa-miR-3679-3p	CLIP-seq
MIRT1498178	hsa-miR-3679-5p	CLIP-seq
MIRT1498067	hsa-miR-3682-5p	CLIP-seq
MIRT1498179	hsa-miR-3691-3p	CLIP-seq
MIRT1498180	hsa-miR-371b-5p	CLIP-seq
MIRT1498068	hsa-miR-376a	CLIP-seq
MIRT1498069	hsa-miR-376b	CLIP-seq
MIRT1498181	hsa-miR-381	CLIP-seq
MIRT1498182	hsa-miR-3908	CLIP-seq
MIRT1498183	hsa-miR-3942-5p	CLIP-seq
MIRT1498184	hsa-miR-3943	CLIP-seq
MIRT1498185	hsa-miR-3972	CLIP-seq
MIRT1498186	hsa-miR-410	CLIP-seq
MIRT1498070	hsa-miR-421	CLIP-seq
MIRT1498187	hsa-miR-423-5p	CLIP-seq
MIRT1498188	hsa-miR-424	CLIP-seq
MIRT1498189	hsa-miR-4267	CLIP-seq
MIRT1498190	hsa-miR-4284	CLIP-seq
MIRT1498191	hsa-miR-429	CLIP-seq
MIRT1498192	hsa-miR-4291	CLIP-seq
MIRT1498193	hsa-miR-4310	CLIP-seq
MIRT1498194	hsa-miR-4327	CLIP-seq
MIRT1498195	hsa-miR-4423-3p	CLIP-seq
MIRT1498074	hsa-miR-4424	CLIP-seq
MIRT1498075	hsa-miR-4427	CLIP-seq
MIRT1498196	hsa-miR-4429	CLIP-seq
MIRT1498197	hsa-miR-4438	CLIP-seq
MIRT1498077	hsa-miR-4452	CLIP-seq
MIRT1498198	hsa-miR-4458	CLIP-seq
MIRT1498199	hsa-miR-4470	CLIP-seq
MIRT1498200	hsa-miR-4474-3p	CLIP-seq
MIRT1498201	hsa-miR-4482	CLIP-seq
MIRT1498202	hsa-miR-4493	CLIP-seq
MIRT1498203	hsa-miR-4500	CLIP-seq
MIRT1498204	hsa-miR-4503	CLIP-seq
MIRT1498079	hsa-miR-450b-5p	CLIP-seq
MIRT1498205	hsa-miR-4517	CLIP-seq
MIRT1498206	hsa-miR-4524	CLIP-seq
MIRT1498207	hsa-miR-4529-5p	CLIP-seq
MIRT1498208	hsa-miR-4635	CLIP-seq
MIRT1498209	hsa-miR-4642	CLIP-seq
MIRT1498210	hsa-miR-4652-3p	CLIP-seq
MIRT1498211	hsa-miR-4662a-3p	CLIP-seq
MIRT1498212	hsa-miR-4666-3p	CLIP-seq
MIRT1498213	hsa-miR-4668-3p	CLIP-seq
MIRT1498083	hsa-miR-4680-3p	CLIP-seq
MIRT1498214	hsa-miR-4685-5p	CLIP-seq
MIRT1498215	hsa-miR-4686	CLIP-seq
MIRT1498216	hsa-miR-4698	CLIP-seq
MIRT1498217	hsa-miR-4703-5p	CLIP-seq
MIRT1498087	hsa-miR-4709-3p	CLIP-seq
MIRT1498218	hsa-miR-4714-3p	CLIP-seq
MIRT1498088	hsa-miR-4715-3p	CLIP-seq
MIRT1498219	hsa-miR-4724-5p	CLIP-seq
MIRT1498220	hsa-miR-4733-5p	CLIP-seq
MIRT1498221	hsa-miR-4737	CLIP-seq
MIRT1498090	hsa-miR-4738-3p	CLIP-seq
MIRT1498091	hsa-miR-4755-3p	CLIP-seq
MIRT1498092	hsa-miR-4760-3p	CLIP-seq
MIRT1498222	hsa-miR-4765	CLIP-seq
MIRT1498223	hsa-miR-4766-5p	CLIP-seq
MIRT1498094	hsa-miR-4773	CLIP-seq
MIRT1498224	hsa-miR-4776-3p	CLIP-seq
MIRT1498225	hsa-miR-4793-3p	CLIP-seq
MIRT1498226	hsa-miR-483-3p	CLIP-seq
MIRT756105	hsa-miR-484	CLIP-seq
MIRT1498096	hsa-miR-493	CLIP-seq
MIRT1498227	hsa-miR-497	CLIP-seq
MIRT1498228	hsa-miR-503	CLIP-seq
MIRT1498099	hsa-miR-507	CLIP-seq
MIRT1498229	hsa-miR-514	CLIP-seq
MIRT1498230	hsa-miR-514b-3p	CLIP-seq
MIRT1498231	hsa-miR-543	CLIP-seq
MIRT1498104	hsa-miR-544	CLIP-seq
MIRT1498232	hsa-miR-545	CLIP-seq
MIRT1498105	hsa-miR-548ag	CLIP-seq
MIRT1498106	hsa-miR-548ai	CLIP-seq
MIRT1498233	hsa-miR-548h	CLIP-seq
MIRT1498234	hsa-miR-548j	CLIP-seq
MIRT1498235	hsa-miR-548o	CLIP-seq
MIRT1498107	hsa-miR-548v	CLIP-seq
MIRT1498236	hsa-miR-554	CLIP-seq
MIRT1498108	hsa-miR-557	CLIP-seq
MIRT1498109	hsa-miR-561	CLIP-seq
MIRT1498237	hsa-miR-562	CLIP-seq
MIRT1498238	hsa-miR-569	CLIP-seq
MIRT1498239	hsa-miR-582-3p	CLIP-seq
MIRT1498110	hsa-miR-583	CLIP-seq
MIRT1498112	hsa-miR-590-5p	CLIP-seq
MIRT1498240	hsa-miR-595	CLIP-seq
MIRT1498241	hsa-miR-612	CLIP-seq
MIRT1498113	hsa-miR-618	CLIP-seq
MIRT1498242	hsa-miR-646	CLIP-seq
MIRT1498243	hsa-miR-648	CLIP-seq
MIRT1498116	hsa-miR-885-3p	CLIP-seq
MIRT1498244	hsa-miR-888	CLIP-seq
MIRT1498245	hsa-miR-892b	CLIP-seq
MIRT1498246	hsa-miR-98	CLIP-seq
MIRT1555655	hsa-miR-297	CLIP-seq
MIRT1555656	hsa-miR-567	CLIP-seq
MIRT1498042	hsa-miR-128	CLIP-seq
MIRT1921076	hsa-miR-3927	CLIP-seq
MIRT1921077	hsa-miR-4650-3p	CLIP-seq
MIRT1921344	hsa-miR-196a	CLIP-seq
MIRT1921345	hsa-miR-196b	CLIP-seq
MIRT1921076	hsa-miR-3927	CLIP-seq
MIRT1921077	hsa-miR-4650-3p	CLIP-seq
MIRT2150079	hsa-miR-1236	CLIP-seq
MIRT1498045	hsa-miR-141	CLIP-seq
MIRT1498133	hsa-miR-15a	CLIP-seq
MIRT1498134	hsa-miR-15b	CLIP-seq
MIRT1498135	hsa-miR-16	CLIP-seq
MIRT1498140	hsa-miR-195	CLIP-seq
MIRT1498049	hsa-miR-200a	CLIP-seq
MIRT1498050	hsa-miR-205	CLIP-seq
MIRT1498051	hsa-miR-21	CLIP-seq
MIRT2150080	hsa-miR-3675-3p	CLIP-seq
MIRT1498188	hsa-miR-424	CLIP-seq
MIRT1498227	hsa-miR-497	CLIP-seq
MIRT2150081	hsa-miR-548aa	CLIP-seq
MIRT1498238	hsa-miR-569	CLIP-seq
MIRT1498112	hsa-miR-590-5p	CLIP-seq
MIRT2150082	hsa-miR-889	CLIP-seq
MIRT1498133	hsa-miR-15a	CLIP-seq
MIRT1498134	hsa-miR-15b	CLIP-seq
MIRT1498135	hsa-miR-16	CLIP-seq
MIRT1498140	hsa-miR-195	CLIP-seq
MIRT1498188	hsa-miR-424	CLIP-seq
MIRT1498227	hsa-miR-497	CLIP-seq
MIRT1498117	hsa-let-7a	CLIP-seq
MIRT1498118	hsa-let-7b	CLIP-seq
MIRT1498119	hsa-let-7c	CLIP-seq
MIRT1498120	hsa-let-7d	CLIP-seq
MIRT1498121	hsa-let-7e	CLIP-seq
MIRT1498122	hsa-let-7f	CLIP-seq
MIRT1498123	hsa-let-7g	CLIP-seq
MIRT1498124	hsa-let-7i	CLIP-seq
MIRT1498035	hsa-miR-101	CLIP-seq
MIRT1498036	hsa-miR-103b	CLIP-seq
MIRT2370129	hsa-miR-1180	CLIP-seq
MIRT1498125	hsa-miR-1184	CLIP-seq
MIRT1498126	hsa-miR-1185	CLIP-seq
MIRT1498127	hsa-miR-1202	CLIP-seq
MIRT1498128	hsa-miR-1205	CLIP-seq
MIRT1498037	hsa-miR-1206	CLIP-seq
MIRT1498038	hsa-miR-1227	CLIP-seq
MIRT2150079	hsa-miR-1236	CLIP-seq
MIRT2370130	hsa-miR-1244	CLIP-seq
MIRT1498129	hsa-miR-1245	CLIP-seq
MIRT2370131	hsa-miR-1245b-3p	CLIP-seq
MIRT2370132	hsa-miR-1253	CLIP-seq
MIRT1498039	hsa-miR-1264	CLIP-seq
MIRT2370133	hsa-miR-1275	CLIP-seq
MIRT1498040	hsa-miR-1276	CLIP-seq
MIRT1498041	hsa-miR-1278	CLIP-seq
MIRT2370134	hsa-miR-1279	CLIP-seq
MIRT1498042	hsa-miR-128	CLIP-seq
MIRT1498130	hsa-miR-1285	CLIP-seq
MIRT2370135	hsa-miR-1287	CLIP-seq
MIRT2370136	hsa-miR-129-5p	CLIP-seq
MIRT1498043	hsa-miR-1305	CLIP-seq
MIRT2370137	hsa-miR-132	CLIP-seq
MIRT1498132	hsa-miR-1323	CLIP-seq
MIRT2370138	hsa-miR-136	CLIP-seq
MIRT2370139	hsa-miR-138	CLIP-seq
MIRT2370140	hsa-miR-140-3p	CLIP-seq
MIRT1498045	hsa-miR-141	CLIP-seq
MIRT1498046	hsa-miR-142-5p	CLIP-seq
MIRT1498133	hsa-miR-15a	CLIP-seq
MIRT1498134	hsa-miR-15b	CLIP-seq
MIRT1498135	hsa-miR-16	CLIP-seq
MIRT2370141	hsa-miR-181a	CLIP-seq
MIRT2370142	hsa-miR-181b	CLIP-seq
MIRT2370143	hsa-miR-181c	CLIP-seq
MIRT2370144	hsa-miR-181d	CLIP-seq
MIRT1498136	hsa-miR-186	CLIP-seq
MIRT2370145	hsa-miR-1913	CLIP-seq
MIRT1498140	hsa-miR-195	CLIP-seq
MIRT1921344	hsa-miR-196a	CLIP-seq
MIRT1921345	hsa-miR-196b	CLIP-seq
MIRT2370146	hsa-miR-199b-3p	CLIP-seq
MIRT1498049	hsa-miR-200a	CLIP-seq
MIRT1498143	hsa-miR-202	CLIP-seq
MIRT1498050	hsa-miR-205	CLIP-seq
MIRT2370147	hsa-miR-2052	CLIP-seq
MIRT1498051	hsa-miR-21	CLIP-seq
MIRT2370148	hsa-miR-2113	CLIP-seq
MIRT1498052	hsa-miR-2117	CLIP-seq
MIRT2370149	hsa-miR-212	CLIP-seq
MIRT1498053	hsa-miR-22	CLIP-seq
MIRT1498054	hsa-miR-221	CLIP-seq
MIRT1498055	hsa-miR-222	CLIP-seq
MIRT2370150	hsa-miR-224	CLIP-seq
MIRT2370151	hsa-miR-2467-5p	CLIP-seq
MIRT1498056	hsa-miR-27a	CLIP-seq
MIRT1498057	hsa-miR-27b	CLIP-seq
MIRT2370152	hsa-miR-28-5p	CLIP-seq
MIRT2370153	hsa-miR-299-3p	CLIP-seq
MIRT1498144	hsa-miR-300	CLIP-seq
MIRT1498058	hsa-miR-3064-3p	CLIP-seq
MIRT2370154	hsa-miR-3074-3p	CLIP-seq
MIRT1498145	hsa-miR-3119	CLIP-seq
MIRT2370155	hsa-miR-3129-5p	CLIP-seq
MIRT1498147	hsa-miR-3130-3p	CLIP-seq
MIRT1498149	hsa-miR-3133	CLIP-seq
MIRT2370156	hsa-miR-3135	CLIP-seq
MIRT2370157	hsa-miR-3135b	CLIP-seq
MIRT2370158	hsa-miR-3139	CLIP-seq
MIRT1498150	hsa-miR-3140-3p	CLIP-seq
MIRT1498151	hsa-miR-3143	CLIP-seq
MIRT2370159	hsa-miR-3145-5p	CLIP-seq
MIRT2370160	hsa-miR-3148	CLIP-seq
MIRT2370161	hsa-miR-3152-5p	CLIP-seq
MIRT2370162	hsa-miR-3153	CLIP-seq
MIRT2370163	hsa-miR-3154	CLIP-seq
MIRT1498152	hsa-miR-3155	CLIP-seq
MIRT1498153	hsa-miR-3155b	CLIP-seq
MIRT2370164	hsa-miR-3156-5p	CLIP-seq
MIRT2370165	hsa-miR-3157-3p	CLIP-seq
MIRT1498061	hsa-miR-3157-5p	CLIP-seq
MIRT1498154	hsa-miR-3158-5p	CLIP-seq
MIRT1498155	hsa-miR-3163	CLIP-seq
MIRT2370166	hsa-miR-3166	CLIP-seq
MIRT1498156	hsa-miR-3180-5p	CLIP-seq
MIRT1498157	hsa-miR-3182	CLIP-seq
MIRT1498160	hsa-miR-3187-5p	CLIP-seq
MIRT2370167	hsa-miR-3188	CLIP-seq
MIRT2370168	hsa-miR-3189-5p	CLIP-seq
MIRT1498161	hsa-miR-320a	CLIP-seq
MIRT1498162	hsa-miR-320b	CLIP-seq
MIRT1498163	hsa-miR-320c	CLIP-seq
MIRT1498164	hsa-miR-320d	CLIP-seq
MIRT1498165	hsa-miR-323-3p	CLIP-seq
MIRT2370169	hsa-miR-323b-3p	CLIP-seq
MIRT2370170	hsa-miR-324-3p	CLIP-seq
MIRT1498166	hsa-miR-330-3p	CLIP-seq
MIRT1498167	hsa-miR-338-5p	CLIP-seq
MIRT1498168	hsa-miR-33a	CLIP-seq
MIRT1498169	hsa-miR-33b	CLIP-seq
MIRT1498062	hsa-miR-340	CLIP-seq
MIRT1498063	hsa-miR-346	CLIP-seq
MIRT2370171	hsa-miR-3607-3p	CLIP-seq
MIRT1498170	hsa-miR-361-3p	CLIP-seq
MIRT2370172	hsa-miR-361-5p	CLIP-seq
MIRT2370173	hsa-miR-3616-3p	CLIP-seq
MIRT1498064	hsa-miR-3617	CLIP-seq
MIRT1498171	hsa-miR-3622a-3p	CLIP-seq
MIRT1498172	hsa-miR-3622a-5p	CLIP-seq
MIRT1498173	hsa-miR-3622b-3p	CLIP-seq
MIRT1498065	hsa-miR-3646	CLIP-seq
MIRT2370174	hsa-miR-3654	CLIP-seq
MIRT1498066	hsa-miR-3662	CLIP-seq
MIRT1498174	hsa-miR-3663-3p	CLIP-seq
MIRT1498175	hsa-miR-3667-3p	CLIP-seq
MIRT2370175	hsa-miR-3671	CLIP-seq
MIRT2150080	hsa-miR-3675-3p	CLIP-seq
MIRT1498177	hsa-miR-3679-3p	CLIP-seq
MIRT1498178	hsa-miR-3679-5p	CLIP-seq
MIRT2370176	hsa-miR-3680	CLIP-seq
MIRT1498067	hsa-miR-3682-5p	CLIP-seq
MIRT2370177	hsa-miR-3686	CLIP-seq
MIRT2370178	hsa-miR-3688-3p	CLIP-seq
MIRT2370179	hsa-miR-3688-5p	CLIP-seq
MIRT1498179	hsa-miR-3691-3p	CLIP-seq
MIRT2370180	hsa-miR-3692	CLIP-seq
MIRT1498180	hsa-miR-371b-5p	CLIP-seq
MIRT1498068	hsa-miR-376a	CLIP-seq
MIRT1498069	hsa-miR-376b	CLIP-seq
MIRT2370181	hsa-miR-380	CLIP-seq
MIRT1498181	hsa-miR-381	CLIP-seq
MIRT1498182	hsa-miR-3908	CLIP-seq
MIRT2370182	hsa-miR-3910	CLIP-seq
MIRT2370183	hsa-miR-3914	CLIP-seq
MIRT2370184	hsa-miR-3923	CLIP-seq
MIRT2370185	hsa-miR-3924	CLIP-seq
MIRT1921076	hsa-miR-3927	CLIP-seq
MIRT2370186	hsa-miR-3941	CLIP-seq
MIRT1498184	hsa-miR-3943	CLIP-seq
MIRT1498185	hsa-miR-3972	CLIP-seq
MIRT2370187	hsa-miR-3975	CLIP-seq
MIRT2370188	hsa-miR-3978	CLIP-seq
MIRT1498186	hsa-miR-410	CLIP-seq
MIRT2370189	hsa-miR-412	CLIP-seq
MIRT1498070	hsa-miR-421	CLIP-seq
MIRT1498188	hsa-miR-424	CLIP-seq
MIRT1498071	hsa-miR-4252	CLIP-seq
MIRT2370190	hsa-miR-4257	CLIP-seq
MIRT2370191	hsa-miR-4261	CLIP-seq
MIRT2370192	hsa-miR-4262	CLIP-seq
MIRT2370193	hsa-miR-4265	CLIP-seq
MIRT1498189	hsa-miR-4267	CLIP-seq
MIRT2370194	hsa-miR-4268	CLIP-seq
MIRT2370195	hsa-miR-4275	CLIP-seq
MIRT1498190	hsa-miR-4284	CLIP-seq
MIRT2370196	hsa-miR-4290	CLIP-seq
MIRT1498192	hsa-miR-4291	CLIP-seq
MIRT2370197	hsa-miR-4293	CLIP-seq
MIRT2370198	hsa-miR-4296	CLIP-seq
MIRT2370199	hsa-miR-4307	CLIP-seq
MIRT1498193	hsa-miR-4310	CLIP-seq
MIRT1498073	hsa-miR-4311	CLIP-seq
MIRT2370200	hsa-miR-4322	CLIP-seq
MIRT2370201	hsa-miR-4326	CLIP-seq
MIRT1498194	hsa-miR-4327	CLIP-seq
MIRT2370202	hsa-miR-433	CLIP-seq
MIRT2370203	hsa-miR-4330	CLIP-seq
MIRT2370204	hsa-miR-4420	CLIP-seq
MIRT1498195	hsa-miR-4423-3p	CLIP-seq
MIRT1498074	hsa-miR-4424	CLIP-seq
MIRT1498075	hsa-miR-4427	CLIP-seq
MIRT1498196	hsa-miR-4429	CLIP-seq
MIRT2370205	hsa-miR-4434	CLIP-seq
MIRT2370206	hsa-miR-4436b-5p	CLIP-seq
MIRT1498197	hsa-miR-4438	CLIP-seq
MIRT2370207	hsa-miR-4448	CLIP-seq
MIRT1498077	hsa-miR-4452	CLIP-seq
MIRT2370208	hsa-miR-4455	CLIP-seq
MIRT1498198	hsa-miR-4458	CLIP-seq
MIRT1498078	hsa-miR-4477a	CLIP-seq
MIRT2370209	hsa-miR-4491	CLIP-seq
MIRT1498202	hsa-miR-4493	CLIP-seq
MIRT2370210	hsa-miR-4494	CLIP-seq
MIRT2370211	hsa-miR-4495	CLIP-seq
MIRT1498203	hsa-miR-4500	CLIP-seq
MIRT1498204	hsa-miR-4503	CLIP-seq
MIRT2370212	hsa-miR-4504	CLIP-seq
MIRT1498079	hsa-miR-450b-5p	CLIP-seq
MIRT2370213	hsa-miR-4511	CLIP-seq
MIRT2370214	hsa-miR-4516	CLIP-seq
MIRT1498205	hsa-miR-4517	CLIP-seq
MIRT1498081	hsa-miR-452	CLIP-seq
MIRT1498206	hsa-miR-4524	CLIP-seq
MIRT2370215	hsa-miR-4633-5p	CLIP-seq
MIRT1498208	hsa-miR-4635	CLIP-seq
MIRT2370216	hsa-miR-4638-3p	CLIP-seq
MIRT1498209	hsa-miR-4642	CLIP-seq
MIRT2370217	hsa-miR-4649-3p	CLIP-seq
MIRT1921077	hsa-miR-4650-3p	CLIP-seq
MIRT1498210	hsa-miR-4652-3p	CLIP-seq
MIRT2370218	hsa-miR-4657	CLIP-seq
MIRT2370219	hsa-miR-4659a-5p	CLIP-seq
MIRT2370220	hsa-miR-4659b-5p	CLIP-seq
MIRT2370221	hsa-miR-466	CLIP-seq
MIRT2370222	hsa-miR-4664-3p	CLIP-seq
MIRT2370223	hsa-miR-4665-5p	CLIP-seq
MIRT1498212	hsa-miR-4666-3p	CLIP-seq
MIRT2370224	hsa-miR-4667-3p	CLIP-seq
MIRT1498213	hsa-miR-4668-3p	CLIP-seq
MIRT2370225	hsa-miR-4668-5p	CLIP-seq
MIRT2370226	hsa-miR-4672	CLIP-seq
MIRT1498082	hsa-miR-4676-3p	CLIP-seq
MIRT1498083	hsa-miR-4680-3p	CLIP-seq
MIRT1498085	hsa-miR-4684-5p	CLIP-seq
MIRT1498214	hsa-miR-4685-5p	CLIP-seq
MIRT2370227	hsa-miR-4691-5p	CLIP-seq
MIRT1498086	hsa-miR-4693-5p	CLIP-seq
MIRT1498216	hsa-miR-4698	CLIP-seq
MIRT1498087	hsa-miR-4709-3p	CLIP-seq
MIRT2370228	hsa-miR-4711-3p	CLIP-seq
MIRT1498218	hsa-miR-4714-3p	CLIP-seq
MIRT1498088	hsa-miR-4715-3p	CLIP-seq
MIRT2370229	hsa-miR-4716-5p	CLIP-seq
MIRT1498089	hsa-miR-4727-5p	CLIP-seq
MIRT2370230	hsa-miR-4731-3p	CLIP-seq
MIRT1498220	hsa-miR-4733-5p	CLIP-seq
MIRT1498221	hsa-miR-4737	CLIP-seq
MIRT1498090	hsa-miR-4738-3p	CLIP-seq
MIRT2370231	hsa-miR-4742-3p	CLIP-seq
MIRT1498091	hsa-miR-4755-3p	CLIP-seq
MIRT2370232	hsa-miR-4758-3p	CLIP-seq
MIRT1498092	hsa-miR-4760-3p	CLIP-seq
MIRT2370233	hsa-miR-4761-3p	CLIP-seq
MIRT1498093	hsa-miR-4761-5p	CLIP-seq
MIRT2370234	hsa-miR-4762-5p	CLIP-seq
MIRT1498222	hsa-miR-4765	CLIP-seq
MIRT1498223	hsa-miR-4766-5p	CLIP-seq
MIRT2370235	hsa-miR-4768-3p	CLIP-seq
MIRT2370236	hsa-miR-4769-3p	CLIP-seq
MIRT2370237	hsa-miR-4771	CLIP-seq
MIRT2370238	hsa-miR-4772-3p	CLIP-seq
MIRT1498094	hsa-miR-4773	CLIP-seq
MIRT2370239	hsa-miR-4774-3p	CLIP-seq
MIRT1498224	hsa-miR-4776-3p	CLIP-seq
MIRT2370240	hsa-miR-4777-5p	CLIP-seq
MIRT1498095	hsa-miR-4786-5p	CLIP-seq
MIRT2370241	hsa-miR-4789-3p	CLIP-seq
MIRT1498225	hsa-miR-4793-3p	CLIP-seq
MIRT2370242	hsa-miR-4795-3p	CLIP-seq
MIRT2370243	hsa-miR-4797-5p	CLIP-seq
MIRT2370244	hsa-miR-4798-3p	CLIP-seq
MIRT2370245	hsa-miR-4801	CLIP-seq
MIRT2370246	hsa-miR-4803	CLIP-seq
MIRT1498226	hsa-miR-483-3p	CLIP-seq
MIRT756105	hsa-miR-484	CLIP-seq
MIRT2370247	hsa-miR-485-5p	CLIP-seq
MIRT2370248	hsa-miR-486-5p	CLIP-seq
MIRT2370249	hsa-miR-491-3p	CLIP-seq
MIRT1498096	hsa-miR-493	CLIP-seq
MIRT1498227	hsa-miR-497	CLIP-seq
MIRT2370250	hsa-miR-498	CLIP-seq
MIRT2370251	hsa-miR-499-3p	CLIP-seq
MIRT2370252	hsa-miR-499a-3p	CLIP-seq
MIRT1498228	hsa-miR-503	CLIP-seq
MIRT1498099	hsa-miR-507	CLIP-seq
MIRT2370253	hsa-miR-513a-3p	CLIP-seq
MIRT1498100	hsa-miR-513a-5p	CLIP-seq
MIRT1498101	hsa-miR-513b	CLIP-seq
MIRT1498229	hsa-miR-514	CLIP-seq
MIRT1498230	hsa-miR-514b-3p	CLIP-seq
MIRT2370254	hsa-miR-518d-5p	CLIP-seq
MIRT2370255	hsa-miR-519b-5p	CLIP-seq
MIRT2370256	hsa-miR-519c-5p	CLIP-seq
MIRT2370257	hsa-miR-520c-5p	CLIP-seq
MIRT1498102	hsa-miR-520d-5p	CLIP-seq
MIRT1498103	hsa-miR-524-5p	CLIP-seq
MIRT2370258	hsa-miR-526a	CLIP-seq
MIRT2370259	hsa-miR-532-5p	CLIP-seq
MIRT2370260	hsa-miR-542-3p	CLIP-seq
MIRT1498231	hsa-miR-543	CLIP-seq
MIRT1498104	hsa-miR-544	CLIP-seq
MIRT2370261	hsa-miR-548a-3p	CLIP-seq
MIRT2150081	hsa-miR-548aa	CLIP-seq
MIRT1498105	hsa-miR-548ag	CLIP-seq
MIRT1498106	hsa-miR-548ai	CLIP-seq
MIRT2370262	hsa-miR-548b-3p	CLIP-seq
MIRT2370263	hsa-miR-548c-3p	CLIP-seq
MIRT2370264	hsa-miR-548e	CLIP-seq
MIRT2370265	hsa-miR-548f	CLIP-seq
MIRT1498233	hsa-miR-548h	CLIP-seq
MIRT1498234	hsa-miR-548j	CLIP-seq
MIRT2370266	hsa-miR-548m	CLIP-seq
MIRT1498235	hsa-miR-548o	CLIP-seq
MIRT2370267	hsa-miR-548q	CLIP-seq
MIRT2370268	hsa-miR-548t	CLIP-seq
MIRT1498107	hsa-miR-548v	CLIP-seq
MIRT2370269	hsa-miR-550b	CLIP-seq
MIRT1498236	hsa-miR-554	CLIP-seq
MIRT2370270	hsa-miR-556-3p	CLIP-seq
MIRT2370271	hsa-miR-556-5p	CLIP-seq
MIRT1498108	hsa-miR-557	CLIP-seq
MIRT1498109	hsa-miR-561	CLIP-seq
MIRT1498237	hsa-miR-562	CLIP-seq
MIRT1498238	hsa-miR-569	CLIP-seq
MIRT2370272	hsa-miR-570	CLIP-seq
MIRT1498239	hsa-miR-582-3p	CLIP-seq
MIRT1498110	hsa-miR-583	CLIP-seq
MIRT2370273	hsa-miR-587	CLIP-seq
MIRT1498112	hsa-miR-590-5p	CLIP-seq
MIRT1498240	hsa-miR-595	CLIP-seq
MIRT756428	hsa-miR-596	CLIP-seq
MIRT2370274	hsa-miR-605	CLIP-seq
MIRT2370275	hsa-miR-606	CLIP-seq
MIRT2370276	hsa-miR-607	CLIP-seq
MIRT2370277	hsa-miR-609	CLIP-seq
MIRT1498241	hsa-miR-612	CLIP-seq
MIRT1498113	hsa-miR-618	CLIP-seq
MIRT2370278	hsa-miR-621	CLIP-seq
MIRT1498114	hsa-miR-622	CLIP-seq
MIRT2370279	hsa-miR-625	CLIP-seq
MIRT1498115	hsa-miR-641	CLIP-seq
MIRT2370280	hsa-miR-642b	CLIP-seq
MIRT2370281	hsa-miR-643	CLIP-seq
MIRT1498242	hsa-miR-646	CLIP-seq
MIRT1498243	hsa-miR-648	CLIP-seq
MIRT2370282	hsa-miR-656	CLIP-seq
MIRT2370283	hsa-miR-664	CLIP-seq
MIRT2370284	hsa-miR-665	CLIP-seq
MIRT2370285	hsa-miR-708	CLIP-seq
MIRT2370286	hsa-miR-874	CLIP-seq
MIRT2370287	hsa-miR-877	CLIP-seq
MIRT1498116	hsa-miR-885-3p	CLIP-seq
MIRT1498244	hsa-miR-888	CLIP-seq
MIRT2150082	hsa-miR-889	CLIP-seq
MIRT2370288	hsa-miR-891b	CLIP-seq
MIRT1498245	hsa-miR-892b	CLIP-seq
MIRT2370289	hsa-miR-9	CLIP-seq
MIRT1498246	hsa-miR-98	CLIP-seq
MIRT1498045	hsa-miR-141	CLIP-seq
MIRT1498133	hsa-miR-15a	CLIP-seq
MIRT1498134	hsa-miR-15b	CLIP-seq
MIRT1498135	hsa-miR-16	CLIP-seq
MIRT1498140	hsa-miR-195	CLIP-seq
MIRT1498049	hsa-miR-200a	CLIP-seq
MIRT1498051	hsa-miR-21	CLIP-seq
MIRT1498188	hsa-miR-424	CLIP-seq
MIRT1498227	hsa-miR-497	CLIP-seq
MIRT1498112	hsa-miR-590-5p	CLIP-seq
MIRT1498050	hsa-miR-205	CLIP-seq
MIRT1498045	hsa-miR-141	CLIP-seq
MIRT1498049	hsa-miR-200a	CLIP-seq
MIRT1498051	hsa-miR-21	CLIP-seq
MIRT1498112	hsa-miR-590-5p	CLIP-seq
MIRT1498038	hsa-miR-1227	CLIP-seq
MIRT2434879	hsa-miR-1262	CLIP-seq
MIRT2370135	hsa-miR-1287	CLIP-seq
MIRT1498043	hsa-miR-1305	CLIP-seq
MIRT2370137	hsa-miR-132	CLIP-seq
MIRT1498045	hsa-miR-141	CLIP-seq
MIRT1498133	hsa-miR-15a	CLIP-seq
MIRT1498134	hsa-miR-15b	CLIP-seq
MIRT1498135	hsa-miR-16	CLIP-seq
MIRT1498140	hsa-miR-195	CLIP-seq
MIRT1498049	hsa-miR-200a	CLIP-seq
MIRT1498050	hsa-miR-205	CLIP-seq
MIRT2370149	hsa-miR-212	CLIP-seq
MIRT2434880	hsa-miR-2278	CLIP-seq
MIRT1555655	hsa-miR-297	CLIP-seq
MIRT1498147	hsa-miR-3130-3p	CLIP-seq
MIRT2370157	hsa-miR-3135b	CLIP-seq
MIRT2370164	hsa-miR-3156-5p	CLIP-seq
MIRT1498061	hsa-miR-3157-5p	CLIP-seq
MIRT1498155	hsa-miR-3163	CLIP-seq
MIRT1498157	hsa-miR-3182	CLIP-seq
MIRT1498165	hsa-miR-323-3p	CLIP-seq
MIRT1498166	hsa-miR-330-3p	CLIP-seq
MIRT1498167	hsa-miR-338-5p	CLIP-seq
MIRT2370173	hsa-miR-3616-3p	CLIP-seq
MIRT1498172	hsa-miR-3622a-5p	CLIP-seq
MIRT2434881	hsa-miR-3650	CLIP-seq
MIRT1498175	hsa-miR-3667-3p	CLIP-seq
MIRT1498179	hsa-miR-3691-3p	CLIP-seq
MIRT1498182	hsa-miR-3908	CLIP-seq
MIRT2370185	hsa-miR-3924	CLIP-seq
MIRT1498186	hsa-miR-410	CLIP-seq
MIRT1498188	hsa-miR-424	CLIP-seq
MIRT2370199	hsa-miR-4307	CLIP-seq
MIRT1498073	hsa-miR-4311	CLIP-seq
MIRT1498195	hsa-miR-4423-3p	CLIP-seq
MIRT1498077	hsa-miR-4452	CLIP-seq
MIRT2370208	hsa-miR-4455	CLIP-seq
MIRT2434882	hsa-miR-4468	CLIP-seq
MIRT1498079	hsa-miR-450b-5p	CLIP-seq
MIRT1498083	hsa-miR-4680-3p	CLIP-seq
MIRT2434883	hsa-miR-4699-5p	CLIP-seq
MIRT2434884	hsa-miR-4701-3p	CLIP-seq
MIRT1498088	hsa-miR-4715-3p	CLIP-seq
MIRT1498220	hsa-miR-4733-5p	CLIP-seq
MIRT1498090	hsa-miR-4738-3p	CLIP-seq
MIRT1498091	hsa-miR-4755-3p	CLIP-seq
MIRT2370233	hsa-miR-4761-3p	CLIP-seq
MIRT1498225	hsa-miR-4793-3p	CLIP-seq
MIRT2370243	hsa-miR-4797-5p	CLIP-seq
MIRT1498226	hsa-miR-483-3p	CLIP-seq
MIRT1498227	hsa-miR-497	CLIP-seq
MIRT2370250	hsa-miR-498	CLIP-seq
MIRT1498099	hsa-miR-507	CLIP-seq
MIRT1498104	hsa-miR-544	CLIP-seq
MIRT1498233	hsa-miR-548h	CLIP-seq
MIRT1498234	hsa-miR-548j	CLIP-seq
MIRT1498108	hsa-miR-557	CLIP-seq
MIRT1498237	hsa-miR-562	CLIP-seq
MIRT1555656	hsa-miR-567	CLIP-seq
MIRT2370272	hsa-miR-570	CLIP-seq
MIRT2370277	hsa-miR-609	CLIP-seq
MIRT2370287	hsa-miR-877	CLIP-seq
MIRT1498125	hsa-miR-1184	CLIP-seq
MIRT1498128	hsa-miR-1205	CLIP-seq
MIRT1498154	hsa-miR-3158-5p	CLIP-seq
MIRT2370261	hsa-miR-548a-3p	CLIP-seq
MIRT2370264	hsa-miR-548e	CLIP-seq
MIRT2370265	hsa-miR-548f	CLIP-seq
MIRT1498053	hsa-miR-22	CLIP-seq
MIRT2370163	hsa-miR-3154	CLIP-seq
MIRT1498064	hsa-miR-3617	CLIP-seq
MIRT2370182	hsa-miR-3910	CLIP-seq
MIRT2370186	hsa-miR-3941	CLIP-seq
MIRT1498205	hsa-miR-4517	CLIP-seq
MIRT1498081	hsa-miR-452	CLIP-seq
MIRT2370219	hsa-miR-4659a-5p	CLIP-seq
MIRT2370220	hsa-miR-4659b-5p	CLIP-seq
MIRT2370221	hsa-miR-466	CLIP-seq
MIRT2370226	hsa-miR-4672	CLIP-seq
MIRT1498082	hsa-miR-4676-3p	CLIP-seq
MIRT1498086	hsa-miR-4693-5p	CLIP-seq
MIRT2370229	hsa-miR-4716-5p	CLIP-seq
MIRT1498089	hsa-miR-4727-5p	CLIP-seq
MIRT2370230	hsa-miR-4731-3p	CLIP-seq
MIRT1498090	hsa-miR-4738-3p	CLIP-seq
MIRT2370236	hsa-miR-4769-3p	CLIP-seq
MIRT1498094	hsa-miR-4773	CLIP-seq
MIRT2370245	hsa-miR-4801	CLIP-seq
MIRT1498104	hsa-miR-544	CLIP-seq
MIRT2370273	hsa-miR-587	CLIP-seq
MIRT1498113	hsa-miR-618	CLIP-seq
MIRT1498114	hsa-miR-622	CLIP-seq
MIRT1498115	hsa-miR-641	CLIP-seq
MIRT1498116	hsa-miR-885-3p	CLIP-seq
MIRT2150082	hsa-miR-889	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	25849865
GO:0000902	Process	Cell morphogenesis	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	18280240
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0001570	Process	Vasculogenesis	IEA
GO:0001674	Component	Female germ cell nucleus	IEA
GO:0001824	Process	Blastocyst development	IEA
GO:0001829	Process	Trophectodermal cell differentiation	IEA
GO:0001894	Process	Tissue homeostasis	IEA
GO:0002067	Process	Glandular epithelial cell differentiation	IEA
GO:0003015	Process	Heart process	IEA
GO:0003143	Process	Embryonic heart tube morphogenesis	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003712	Function	Transcription coregulator activity	IDA	18158288
GO:0003713	Function	Transcription coactivator activity	IBA
GO:0003713	Function	Transcription coactivator activity	IDA	16772533, 18158288, 18280240, 20368466, 25796446, 27380321
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0003713	Function	Transcription coactivator activity	IMP	20123905
GO:0003714	Function	Transcription corepressor activity	IBA
GO:0003714	Function	Transcription corepressor activity	IDA	18158288
GO:0005515	Function	Protein binding	IPI	7644498, 9202023, 9305852, 11278422, 11278685, 15161933, 16166090, 17502622, 17974916, 18158288, 18280240, 18579750, 19439659, 19914168, 20048001, 20368466, 21187284, 21205866, 21376238, 21900206, 22234184, 22525271, 22863277, 22921829, 22948661, 23245941, 23873930, 24211253, 242551
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	35429439
GO:0005634	Component	Nucleus	IDA	17974916, 18158288, 18280240, 20868367, 21145499, 21205866, 25796446, 25849865, 28169360, 29400695, 30865227, 31835537
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISO
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	17974916, 18158288, 21205866, 25849865, 29400695, 31835537
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA
GO:0005829	Component	Cytosol	IDA	30865227
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	31835537
GO:0005886	Component	Plasma membrane	IEA
GO:0005911	Component	Cell-cell junction	IEA
GO:0005911	Component	Cell-cell junction	ISS
GO:0005923	Component	Bicellular tight junction	IEA
GO:0006974	Process	DNA damage response	IDA	18280240
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IMP	29403552
GO:0010629	Process	Negative regulation of gene expression	IMP	29403552
GO:0010837	Process	Regulation of keratinocyte proliferation	IEA
GO:0016020	Component	Membrane	IEA
GO:0030054	Component	Cell junction	IDA
GO:0030216	Process	Keratinocyte differentiation	IEA
GO:0030307	Process	Positive regulation of cell growth	IDA	17974916, 18579750
GO:0030855	Process	Epithelial cell differentiation	IEA
GO:0030857	Process	Negative regulation of epithelial cell differentiation	IEA
GO:0030859	Process	Polarized epithelial cell differentiation	IC	27380321
GO:0030903	Process	Notochord development	IEA
GO:0032570	Process	Response to progesterone	IDA	16772533
GO:0035019	Process	Somatic stem cell population maintenance	IEA
GO:0035265	Process	Organ growth	IEA
GO:0035265	Process	Organ growth	ISS
GO:0035329	Process	Hippo signaling	IBA
GO:0035329	Process	Hippo signaling	IDA	18579750, 19324877
GO:0035329	Process	Hippo signaling	IDA	35429439
GO:0035329	Process	Hippo signaling	IEA
GO:0035329	Process	Hippo signaling	IEA
GO:0035329	Process	Hippo signaling	NAS	21808241
GO:0035329	Process	Hippo signaling	TAS	18158288
GO:0042060	Process	Wound healing	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	IMP	29496737
GO:0045669	Process	Positive regulation of osteoblast differentiation	IEA
GO:0045669	Process	Positive regulation of osteoblast differentiation	IMP	29496737
GO:0045747	Process	Positive regulation of Notch signaling pathway	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	20368466
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	20123905
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	20123905, 25796446
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046622	Process	Positive regulation of organ growth	IEA
GO:0048339	Process	Paraxial mesoderm development	IEA
GO:0048368	Process	Lateral mesoderm development	IEA
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050673	Process	Epithelial cell proliferation	ISS
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IMP	29403552
GO:0050767	Process	Regulation of neurogenesis	IDA	25433207
GO:0060045	Process	Positive regulation of cardiac muscle cell proliferation	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060449	Process	Bud elongation involved in lung branching	IEA
GO:0060487	Process	Lung epithelial cell differentiation	IEA
GO:0060575	Process	Intestinal epithelial cell differentiation	IEA
GO:0060576	Process	Intestinal epithelial cell development	IEA
GO:0060828	Process	Regulation of canonical Wnt signaling pathway	IEA
GO:0061026	Process	Cardiac muscle tissue regeneration	IEA
GO:0061621	Process	Canonical glycolysis	IDA	29298880
GO:0065003	Process	Protein-containing complex assembly	IDA	20368466
GO:0065003	Process	Protein-containing complex assembly	IMP	20123905
GO:0070064	Function	Proline-rich region binding	IEA
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IEA
GO:0070161	Component	Anchoring junction	IEA
GO:0071300	Process	Cellular response to retinoic acid	IEA
GO:0071480	Process	Cellular response to gamma radiation	IDA	18280240
GO:0072091	Process	Regulation of stem cell proliferation	IDA	25433207
GO:0072091	Process	Regulation of stem cell proliferation	IEA
GO:0072307	Process	Regulation of metanephric nephron tubule epithelial cell differentiation	IEA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IEA
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IPI	20123905
GO:0140552	Component	TEAD-YAP complex	IDA	20123905, 20368466
GO:0140552	Component	TEAD-YAP complex	IEA
GO:0140552	Component	TEAD-YAP complex	IPI	25384421
GO:1900182	Process	Positive regulation of protein localization to nucleus	IEA
GO:1900182	Process	Positive regulation of protein localization to nucleus	ISS
GO:1902018	Process	Negative regulation of cilium assembly	IMP	25849865
GO:1902459	Process	Positive regulation of stem cell population maintenance	IEA
GO:1903703	Process	Enterocyte differentiation	IEA
GO:1904036	Process	Negative regulation of epithelial cell apoptotic process	IMP	29403552
GO:2000737	Process	Negative regulation of stem cell differentiation	IEA
GO:2001237	Process	Negative regulation of extrinsic apoptotic signaling pathway	IEA

Other IDs

• MIM: 606608
• HGNC: 16262
• e!Ensembl: ENSG00000137693

Protein

• UniProt ID: P46937
• Protein name: Transcriptional coactivator YAP1 (Yes-associated protein 1) (Protein yorkie homolog) (Yes-associated protein YAP65 homolog)
• Protein function: Transcriptional regulator with dual roles as a coactivator and corepressor. Critical downstream regulatory target in the Hippo signaling pathway, crucial for organ size control and tumor suppression by restricting proliferation and promoting apo
• PDB: 1JMQ, 1K5R, 1K9Q, 1K9R, 2LAW, 2LAX, 2LAY, 2LTV, 2LTW, 3KYS, 3MHR, 4RE1, 4REX, 5OAQ, 5YDX, 5YDY, 6G6X, 6G8I, 6G8J, 6G8K, 6G8L, 6G8P, 6G8Q, 6GE3, 6GE4, 6GE5, 6GE6, 6GEC, 6GEE, 6GEG, 6GEI, 6GEK, 6HIK, 6HIL, 6Q2X, 7O07, 8A8Q, 8A8R, 8C2F, 8WRG, 9FZA
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00397	WW	173 → 202	WW domain	Domain
  PF00397	WW	232 → 261	WW domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Increased expression seen in some liver and prostate cancers. Isoforms lacking the transactivation domain found in striatal neurons of patients with Huntington disease (at protein level). {ECO:0000269|PubMed:16461361, ECO:0000269|PubMe
• Sequence:

  MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGD
  SETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTP
  QHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMA
  KTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAM
  TQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNS
  NQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGG
  TQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSV
  DEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSS
  DILNDMESVLAATKLDKESFLTWL

• Sequence length: 504

Pathways

KEGG:

Hippo signaling pathway
Hippo signaling pathway - multiple species

Reactome:

Nuclear signaling by ERBB4
Signaling by Hippo
YAP1- and WWTR1 (TAZ)-stimulated gene expression
RUNX1 regulates transcription of genes involved in differentiation of HSCs
RUNX3 regulates YAP1-mediated transcription
EGR2 and SOX10-mediated initiation of Schwann cell myelination

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Congenital ocular coloboma	Pathogenic	rs587777249	RCV000106407	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Multiple myeloma	Likely pathogenic	rs1591100766	RCV000984109	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Uveal coloboma-cleft lip and palate-intellectual disability	Pathogenic; Likely pathogenic	rs587777250, rs2135086778, rs1950250678	RCV000106408 RCV002246820 RCV001262413	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOBOMA, CLEFT LIP-PALATE AND MENTAL RETARDATION SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOBOMA, OCULAR, WITH OR WITHOUT HEARING IMPAIRMENT, CLEFT LIP/PALATE, AND/OR IMPAIRED INTELLECTUAL DEVELOPMENT	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROBLASTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHABDOMYOSARCOMA, EMBRYONAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA OF HEAD AND NECK	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRIPLE NEGATIVE BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UVEAL COLOBOMA WITH CLEFT LIP AND PALATE AND INTELLECTUAL DISABILITY SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
YAP1-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	31136005		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	31518341		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	28177901		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	29167315		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	25115923, 26056182, 26363011, 28684311, 29163769, 29487002, 29507618, 29674272, 30535506, 31069869, 31137841, 31187136, 31412817		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	26193883		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	26193883, 28130546		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	27705928, 34257617	Associate	★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	26160682		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	26222673, 27966820, 28231263, 28363815, 29412177, 31073205, 31541170		★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	31494105		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	37549144	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anaplasia	Anaplasia	BEFREE	30582455		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	27753655		★☆☆☆☆ Found in Text Mining only
Anencephaly	Anencephaly	Pubtator	32845958	Associate	★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	37549045	Associate	★☆☆☆☆ Found in Text Mining only
Angioma	Angioma	CTD_human_DG	31351048		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	16596258, 28099921, 28381547, 28697132, 29587800, 31352078, 31557131, 31831555, 31849712		★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	39903418	Associate	★☆☆☆☆ Found in Text Mining only
Anophthalmos	Syndromic microphthalmia	BEFREE	28801591		★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	27608489	Inhibit	★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	27608489	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	24720269, 27875740, 28951564		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	30808624		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	33145365, 40281642	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	28293931		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	32308108	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	21666501		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	21666501	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	24720269, 27875740, 28951564		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	28476896, 29794114, 33949409	Associate	★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	38041813	Stimulate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29403552		★☆☆☆☆ Found in Text Mining only
Benign neoplasm of brain, unspecified	Brain Neoplasms	CTD_human_DG	27935819		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	26126522		★☆☆☆☆ Found in Text Mining only
Bilateral microphthalmos	Microphthalmos	BEFREE	28801591		★☆☆☆☆ Found in Text Mining only
Bile Duct Diseases	Bile duct disease	Pubtator	30358741, 30471152	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	24746211	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	25170806, 26163939, 29248722, 29725256, 30397177, 30668336, 31137841, 31207288, 31455378, 31789387		★☆☆☆☆ Found in Text Mining only
Blepharoptosis	Ptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	21666501, 25750037, 27935819		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain neoplasms	Pubtator	21666501	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain Neoplasms	CTD_human_DG	27935819		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Tumor, Primary	Brain Neoplasms	CTD_human_DG	27935819		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23216692, 23340296, 24223879, 25492965, 26136233, 26265440, 26364597, 26678338, 26695440, 27771839, 28102225, 28232662, 28733631, 28886403, 28887324, 28892790, 28931725, 28945218, 28991374, 29329575, 29408336, 29449692, 29581836, 29661856, 29698666, 29848346, 29970036, 30042827, 30055645, 30121333, 30293781, 30678988, 30868052, 30903103, 30967631, 31015465, 31049030, 31085100, 31303470, 31631368, 31785406, 31788936		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	28114269		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21399893, 28524356, 35654829, 40012020	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	23216692, 23949920, 24223879, 24559095, 24648515, 25031743, 25337244, 25417742, 25492965, 25670202, 26265440, 26617849, 26691213, 26885614, 27039292, 27428284, 27555231, 27759563, 27797825, 28232662, 28673931, 28963395, 29109792, 29329575, 29661856, 29728589, 29781562, 29970036, 30055645, 30420728, 31015482, 31085100, 31535669, 31785406, 31788936, 32046779, 32329855, 32692442, 32901856, 32943576, 33121449, 33230261, 33242831, 33247672, 33352739, 33970925, 34126594, 34445421, 34449481, 34463254, 34715882, 35064101, 35182054, 35217640, 35231654, 35773411, 36194598, 36308078, 36309401, 36598329, 36700469, 36774339, 37005481, 37080959, 37081542, 37828756, 37946710, 37957190, 38219531, 38223760, 38565949, 38622197, 39300389, 40157909, 40312366, 40362184	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	31788927	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms Male	Male breast neoplasms	Pubtator	27248471, 27713571, 27987320	Associate	★☆☆☆☆ Found in Text Mining only
Bronchial Diseases	Bronchial disease	Pubtator	33903236, 37150829	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22396793, 23527718, 23558963, 24101154, 24485923, 24860833, 25670202, 25973055, 26039999, 26080399, 26364602, 26549256, 27449093, 27911857, 28232662, 28249901, 28923841, 29104085, 29183995, 29596030, 29950605, 30158528, 30250159, 31015482, 31096145, 31880317, 32054505, 32271880, 32376689, 32457342, 33121449, 33296708, 34039707, 34257617, 34994156, 35014181, 35210364, 35705032, 35712812, 35835915, 35952318, 36008411, 36123390, 36198276, 36280829, 36308276, 36598329, 37117273, 37544381, 38223760, 40295580	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	30466467	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	27129148, 27604489	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	27835600, 28645247		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	24485923, 26119935, 36788083	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	27248471	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19551889, 22098159, 23594797, 23760493, 24086533, 24482231, 24860833, 25087998, 25625370, 26906552, 27437776, 27465555, 27605415, 27765911, 27832779, 27881216, 28076850, 28152516, 28427193, 28472799, 28502290, 28645247, 28815883, 29449645, 29950605, 30180863, 30340922, 30717258, 30999669, 31881970, 32483419, 32626943, 32788868, 33268949, 33846777, 34053234, 34145394, 34257565, 34260811, 34348664, 34565286, 34664408, 34817932, 35435804, 35440025, 35712812, 36764493, 37041150, 37117273, 37151879, 37366601, 37414748, 37980167, 38242197, 40148834, 40191726, 40362400	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28869833	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	31217745	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	23949920	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	36719743	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	25170806, 26163939, 29248722, 29725256, 30397177, 30668336, 31137841, 31207288, 31455378, 31789387		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21856745, 24458094, 24770679, 25115923, 26363011, 26716514, 27231341, 27797825, 27911857, 28684311, 28843361, 29452146, 30006603, 30128013, 30385178, 30389502, 30558661, 30979377, 31633304, 31766357		★☆☆☆☆ Found in Text Mining only
Carcinoma of Male Breast	Breast Carcinoma, male	BEFREE	27248471, 27987320		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	25078107, 27036018, 29949791	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	27034169, 28360038, 28381547, 28475017, 31358620, 31557131, 33501895, 35220277, 35414794, 35455997, 35703534, 35844783, 36008392, 36093484, 36536047, 38247878, 39647834	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26848622, 29850494, 30975094, 33888871, 35937460, 35942760, 36860124, 37211224, 37304674	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	32721553, 33248321, 34534680, 36716535	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	21364637, 23502453, 28177901, 32504288, 33903236, 35289095, 37150829	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	25304677	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	28820907, 29165358, 29875149, 30037824		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	20947521, 24511017, 25369529, 26804165, 27321186, 28339095, 28698296, 29740072, 30546405		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	BEFREE	29875149, 30231971		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	33990626, 40362467	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	29154888		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	29154888		★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	36368426, 36944987, 38255951	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	HPO_DG			★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	21666501		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	28476896	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	29738762, 30840887, 31099044		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	29738762, 30738134, 30840887, 31099044		★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	26160682		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	26222673, 27966820, 28231263, 28363815, 29412177, 31073205, 31541170		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	22098159, 24086533, 24746211, 27465555, 28645247, 30717258, 34182814, 34509526, 34615513, 35449153, 35550144, 36162702	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	24892809, 28645247, 28661054, 28915618, 30815737		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	27129148		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	27129148	Associate	★☆☆☆☆ Found in Text Mining only
Chorioangioma	Chorioangioma	CTD_human_DG	31351048		★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	34615513, 40022181	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	29541248		★☆☆☆☆ Found in Text Mining only
Chronobiology Disorders	Chronobiology disorder	Pubtator	34257617	Associate	★☆☆☆☆ Found in Text Mining only
Cleft palate and bilateral cleft lip	Cleft Palate And Bilateral Cleft Lip	HPO_DG			★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	27864128		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	35604388	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	35604388	Associate	★☆☆☆☆ Found in Text Mining only
Coloboma	Coloboma	Pubtator	28801591	Associate	★☆☆☆☆ Found in Text Mining only
Coloboma of the Retina	Retinal coloboma	BEFREE	28801591		★☆☆☆☆ Found in Text Mining only
Coloboma of the Retina	Retinal coloboma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Coloboma, cleft lip-palate and mental retardation syndrome	Coloboma	ORPHANET_DG	24462371		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOBOMA, OCULAR, WITH OR WITHOUT HEARING IMPAIRMENT, CLEFT LIP/PALATE, AND/OR MENTAL RETARDATION	Ocular Coloboma, With Or Without Hearing Impairment, Cleft Lip/Palate, And/Or Mental Retardation	GENOMICS_ENGLAND_DG	24462371, 27267789, 28801591		★☆☆☆☆ Found in Text Mining only
COLOBOMA, OCULAR, WITH OR WITHOUT HEARING IMPAIRMENT, CLEFT LIP/PALATE, AND/OR MENTAL RETARDATION	Ocular Coloboma, With Or Without Hearing Impairment, Cleft Lip/Palate, And/Or Mental Retardation	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
COLOBOMA, OCULAR, WITH OR WITHOUT HEARING IMPAIRMENT, CLEFT LIP/PALATE, AND/OR MENTAL RETARDATION	Ocular Coloboma, With Or Without Hearing Impairment, Cleft Lip/Palate, And/Or Mental Retardation	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22042863, 22356765, 24323901, 26443705, 27864128, 28241877, 28848049, 28938537, 29512779, 29844307, 29967145		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	18703216	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	29512779, 30833665		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17980593, 23178811, 23372686, 24892549, 24976283, 25388162, 25473897, 26160682, 26443705, 27566107, 28130546, 28356122, 28416184, 28433598, 28435452, 28618450, 28938537, 29037225, 29157094, 29296212, 29312609, 29364502, 29510994, 29770434, 29912317, 30037330, 30099342, 30362561, 30410349, 30456802, 30531836, 30539010, 30555746, 31543507, 31619268, 31717606		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	30510241		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23558963, 26039999, 33472949, 34039707	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23762387, 24323901, 24369055, 24976283, 25388162, 26415221, 27527859, 28249901, 29770434, 30281585, 30531836, 30566960, 30649550, 31543507, 31731190, 31886181, 33611811, 33879786, 34131398, 34974798, 35110552, 35606354, 35611809, 35954207, 36008411, 36147462, 36271545, 36781122, 36983040, 37031206, 37884620, 38057879, 38263746, 38273088	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	27864128, 28130546		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	30510241		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital coloboma of iris	Congenital Coloboma Of Iris	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	28661054, 28915618, 30031758, 30815737		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital contractural arachnodactyly	Pubtator	34615513, 35864972	Associate	★☆☆☆☆ Found in Text Mining only
Congenital ocular coloboma (disorder)	Congenital ocular coloboma	BEFREE	24462371, 26209646, 28801591		★☆☆☆☆ Found in Text Mining only
Congenital ocular coloboma (disorder)	Congenital ocular coloboma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	30582455		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25175178, 28504812, 29416926, 29850494, 29930727, 31179326, 31782549		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	26426694		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	23897276, 30833299		★☆☆☆☆ Found in Text Mining only
Cystic kidney	Cystic Kidney Disease	BEFREE	26967905, 29891559		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	30385786, 30465058, 30496783, 30808624		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	27816394		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	26782911	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	30720184	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30039887, 30511395		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	30720184, 35129398	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	30220545		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	31313295		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	36035287	Associate	★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	31217745	Stimulate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	23022474		★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	28801591		★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	BEFREE	29131252, 29687861		★☆☆☆☆ Found in Text Mining only
Double Outlet Right Ventricle	Double outlet right ventricle	Pubtator	26426694	Associate	★☆☆☆☆ Found in Text Mining only
Dupuytren Contracture	Dupuytren contracture	Pubtator	26458763	Associate	★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	36479120	Associate	★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	BEFREE	25087979, 26496700, 27184927, 28923841, 30353028, 31494105		★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	CTD_human_DG	31494105		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	28202507		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	24972085, 28071680, 31299894, 32457342, 34855209, 37350405, 37744228	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	28608501, 30809297, 31014943		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	31014943, 32728069, 35173685	Associate	★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	26984744, 27022130, 27401149, 28943417, 29354850, 30246434, 30325077, 31477715		★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	29758456		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	29740072, 30546405		★☆☆☆☆ Found in Text Mining only
Epithelioid hemangioendothelioma	Epithelioid Hemangioendothelioma	BEFREE	23737213, 25680571, 25817592, 26050962, 26840265, 28585251, 31537895		★☆☆☆☆ Found in Text Mining only
Epithelioid hemangioendothelioma	Epithelioid Hemangioendothelioma	ORPHANET_DG	24986479		★☆☆☆☆ Found in Text Mining only
Epithelioid hemangioendothelioma	Epithelioid Hemangioendothelioma	Orphanet			★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	24621512, 24906622, 25739674, 28123852, 30563933		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	24621512, 24906622, 25739674, 28123852, 30563933		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	32896069, 34712552, 35930163, 37582812, 40295580	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	30401982, 31116509, 31851786, 31884247, 34260541, 35705994, 35930163, 35962061, 36470870, 37582812, 40295580	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	28671673		★☆☆☆☆ Found in Text Mining only
Eye Diseases	Eye disease	Pubtator	28801591	Associate	★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	29372107		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	34997070	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	26070409		★☆☆☆☆ Found in Text Mining only
Fibrodysplasia Ossificans Progressiva	Fibrodysplasia Ossificans Progressiva	BEFREE	31107558		★☆☆☆☆ Found in Text Mining only
Fibrolamellar Hepatocellular Carcinoma	Hepatocellular Carcinoma	BEFREE	31669305		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	31201834, 31695785		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	28982981		★☆☆☆☆ Found in Text Mining only
Fundus coloboma	Fundus Coloboma	BEFREE	28801591		★☆☆☆☆ Found in Text Mining only
Fundus coloboma	Fundus Coloboma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	25218593		★☆☆☆☆ Found in Text Mining only
gallbladder neoplasm	Neoplasm of gallbladder	BEFREE	25218593		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	21346147, 25743273, 27325246		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	27654712	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	30956759		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	34204585	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	35015027	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21666501, 25750037, 25998128, 26923924, 27935819, 28677425, 29473166, 29780826, 29887596, 30009411, 30082911, 30312684, 30425514, 30665893, 30909436		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	21666501, 26459764, 28677425, 28759011, 29780826, 32717825, 34354698, 34657158, 34987659, 35723276, 36308276, 37083045, 37277696, 37427593	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32777750	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21666501, 25750037, 25998128, 26923924, 28677425, 29473166, 29780826, 29887596, 30009411, 30312684, 30425514, 30665893, 30909436, 31185211		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	24810048, 25750037, 27935819, 28189759, 28627687, 28759011, 28962630, 30006603, 30009411, 30112068, 31185211		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27291091, 28759011, 28790340, 30254296, 31894297, 32777750, 33125099, 34257617, 35054765, 35723276, 37423952, 38220212	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	37565816	Associate	★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	26848622	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	24993889		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	20729916, 35705032, 36753744, 38315837	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	39624011	Inhibit	★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	26426694	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	29351440, 33990626, 36775059	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	30582455		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	34200497	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart Septal Defects Ventricular	Congenital heart septal defect	Pubtator	26426694	Inhibit	★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	CTD_human_DG	31351048		★☆☆☆☆ Found in Text Mining only
Hemangioma, Intramuscular	Hemangioma	CTD_human_DG	31351048		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	28845553, 29084920, 34148063	Associate	★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	29084920, 31409902		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	24813251		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	24813251	Inhibit	★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	31282549	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	35712812	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	22098159, 34978260	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	24837480, 29920228, 30794807, 30863496, 31462641		★☆☆☆☆ Found in Text Mining only
Hepatomegaly	Hepatomegaly	Pubtator	28502290	Associate	★☆☆☆☆ Found in Text Mining only
Hepatomegaly	Hepatomegaly	Pubtator	35835915	Stimulate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	34196131	Associate	★☆☆☆☆ Found in Text Mining only
Histiocytoid hemangioma	Epithelioid hemangioma	CTD_human_DG	31351048		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	35451959	Associate	★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	Pubtator	32289280	Associate	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	40281642	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	18971546, 30385178, 31378107		★☆☆☆☆ Found in Text Mining only
Hypoplastic Left Heart Syndrome	Hypoplastic left heart syndrome	Pubtator	35732239	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	25078107	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	28475017, 30180863, 30254296, 34200497	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30046369, 34257565, 35440025, 35937460	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29563341, 30644438		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	29563341, 34315881	Associate	★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	32289280, 35173685	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	36983040	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	30039887, 30511395		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	36944987	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	30039887, 30511395		★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformations	Intracranial arteriovenous malformation	Pubtator	40332417	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	24837480, 28645247		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	38040893	Inhibit	★☆☆☆☆ Found in Text Mining only
Junctional Epidermolysis Bullosa	Junctional Epidermolysis Bullosa	BEFREE	31091444		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	25195862		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	30720184, 32160412	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	26574480, 31318098		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	34565020	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	30323965, 30907227		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	34323413	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	19111660		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	30320399, 30835743	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	34167441	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	28824329	Associate	★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	27129148	Associate	★☆☆☆☆ Found in Text Mining only
Liposarcoma, Dedifferentiated	liposarcoma	BEFREE	27129148		★☆☆☆☆ Found in Text Mining only
Liposarcoma, well differentiated	liposarcoma	BEFREE	27129148		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19878874, 20226166, 21076472, 23232767, 24101467, 24837480, 24884509, 25087998, 26125451, 26160682, 26771844, 27832779, 28472799, 28645247, 28656879, 28815883, 28866620, 29187885, 29228669, 29245938, 29299170, 29400692, 29449645, 29505957, 29525529, 29627454, 29649630, 29698666, 29950605, 30111512, 30361504, 30676784, 30774374, 30999669, 31146919, 31258779, 31337986, 31358770		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	29698666		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	27465555, 31282549	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	29649630, 31087779		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	24746211, 32317078	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	30471152, 32626943	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	30670575		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	27428308, 29698666, 30206136, 30676784, 31462641, 31754005		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	27555231	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	30385178		★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	29563341	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	29563341		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24810989, 26716514, 27449093, 27797825, 27903989, 27911857, 28177901, 28843361, 29136529, 29901163, 30875659, 31160567, 31316723, 31592232, 31633874, 32521879, 32816858, 33207077, 33296708, 33486901, 35577801, 35864957, 35952318, 36285485, 37150829, 37549045	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	27418196		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	20219076, 23502453, 24175801, 24643316, 31378888, 31886181, 33654199, 34449481, 38250152	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	34978260, 40312366	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	35546636	Associate	★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development, Group II	Malformation of cortical development	BEFREE	28973878		★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	27129148, 29490948		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	28548934		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	24993889, 31817001		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	21245096, 27773750, 29731861, 31119375		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	CTD_human_DG	27935819		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23216692, 23340296, 24223879, 25492965, 26136233, 26265440, 26364597, 26678338, 26695440, 27771839, 28102225, 28232662, 28733631, 28886403, 28887324, 28892790, 28931725, 28945218, 28991374, 29329575, 29408336, 29449692, 29581836, 29661856, 29698666, 29848346, 29970036, 30042827, 30055645, 30121333, 30293781, 30597648, 30678988, 30868052, 30903103, 30967631, 31015465, 31049030, 31085100, 31303470, 31631368, 31772328, 31785406, 31788936		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	28114269		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	28202507		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	24621512, 24906622, 25739674, 28123852, 30563933		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	25218593		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	26811664, 27654712, 29541248, 30539010		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	22012126, 23769673, 24101467, 24837480, 25094049, 26160682, 28076850, 28249813, 28273460, 28416659, 28460446, 28502290, 29187885, 29698666, 30446657, 30565146, 30676784, 31428581, 31613226, 31711043, 31754005		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21856745, 24458094, 24770679, 25115923, 26363011, 26716514, 27231341, 27797825, 27911857, 28684311, 28843361, 29452146, 30006603, 30128013, 30385178, 30389502, 30558661, 30979377, 31633304, 31766357		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	20947521		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	24511017, 25369529, 26804165, 27321186, 28339095, 28698296		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	16596258, 26440309, 28099921, 28253715, 28259973, 28381547, 28475017, 28576749, 28962129, 29587800, 29599309, 30056064, 31383722, 31452251, 31518341, 31558702, 31562256, 31575084, 31810603		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21278236, 26126522, 26701088, 26731476, 27270433, 27832783, 28052036, 29185453, 29372107, 29383141, 30859486		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	29875149		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	21346147, 24175801, 24325916, 24525233, 25846731, 27835600, 28381174, 28885730, 29113304, 29296196, 29367737, 29535422, 29669762, 30134988, 30297104, 30349368, 30934860, 31175271, 31632054, 31796534		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	24810989, 26359368, 27753655, 29845281		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	25170806, 26163939, 29248722, 29725256, 30397177, 30668336, 31137841, 31207288, 31455378, 31789387		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18955139, 21278236, 21610251, 22012126, 22356765, 22891335, 23178811, 23333314, 23527718, 23708000, 24362629, 24810989, 24882515, 24882516, 24937456, 24993351, 25115923, 25218593, 25492964, 25526026, 25670202, 25750037, 25794680, 26050962, 26126522, 26136233, 26263504, 26443705, 26465056, 26701088, 26758663, 26806348, 26876920, 27771839, 27826640, 27911857, 27935819, 28035075, 28098159, 28102225, 28241877, 28253715, 28299672, 28339095, 28376174, 28381174, 28754671, 28892790, 28905448, 28916653, 28923839, 28951564, 28969054, 29017051, 29061667, 29084920, 29088716, 29091762, 29107331, 29167315, 29180467, 29185453, 29212185, 29217192, 29259017, 29299145, 29317486, 29372107, 29396428, 29416926, 29449692, 29452146, 29541248, 29587800, 29597279, 29696628, 29698666, 29739703, 29755126, 29780169, 29781562, 29875149, 29888108, 29891922, 29907586, 29914241, 29976931, 29985391, 30008322, 30017188, 30050119, 30068939, 30078391, 30112068, 30143543, 30167083, 30180862, 30327408, 30341914, 30353028, 30409308, 30446657, 30472188, 30486435, 30504771, 30531836, 30561326, 30676784, 30717152, 30771899, 30833665, 30868052, 30886324, 30901309, 30907227, 30999669, 31066301, 31216773, 31303470, 31372056, 31393050, 31416916, 31428581, 31448276, 31494105, 31557131, 31562256, 31575084, 31578200, 31619268, 31635084, 31637239, 31817001		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	29438691, 29438698		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	29738762, 30840887, 31099044		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22042863, 22356765, 24323901, 26443705, 27864128, 28241877, 28848049, 28938537, 29512779, 29844307, 29967145		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	28114269		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18617895		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	26695440, 29109792, 31352078		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	28114269		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	28114269		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	23685355, 28861609		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	26222673, 27966820, 28231263, 28363815, 29412177, 29582169, 31073205, 31541170		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	28231263, 35320876, 38384024	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	23897276, 29299145, 29382670, 29545604, 29956757, 30106445, 30396386, 30662519, 30833299		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	25628125, 26668268, 29545604, 30558661, 30657954, 32749065, 34468072, 34819356, 35440004, 35798875, 38169595	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	25628125	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	LHGDN	18953429		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	18953429, 35986430	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	22618028		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	18725387, 29212185		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	LHGDN	18725387		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	28470935, 31755214, 32277165, 35689194, 36740402, 37165917	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	28470935, 29575535, 30739911, 31755214, 35262190, 35689194, 36740402	Associate	★☆☆☆☆ Found in Text Mining only
MICROPHTHALMIA, ISOLATED, WITH COLOBOMA 7	Microphthalmia With Coloboma	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
MICROPHTHALMIA, SYNDROMIC 7	Syndromic microphthalmia	BEFREE	30898787		★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	Pubtator	28801591	Associate	★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	HPO_DG			★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	GWASCAT_DG	27322543		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	28698384, 35091324	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	29436693, 30875659	Inhibit	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	37150829	Associate	★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	30755531		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	35414790	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Multiple Sclerosis	Multiple sclerosis	Pubtator	33833274	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	33990626	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	27599610, 28103766, 29061667		★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorder Chronic with Eosinophilia	Myeloproliferative disorder	Pubtator	24378265	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	18971546, 29358670, 30582455		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	37681853	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	29154888		★☆☆☆☆ Found in Text Mining only
Myotonia Congenita	Myotonia congenita	Pubtator	32231000	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	37382248	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	24214394, 34558868, 37173390, 37558679, 39624011	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	39624011	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	35546636	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18158288, 18579750, 18617895, 18725387, 19878874, 20226166, 20841485, 20951342, 20972459, 21484931, 21610251, 22098159, 22618028, 22710434, 22825057, 23422184, 23527718, 23685355, 24334454, 24362629, 24378265, 24525233, 24581491, 24726915, 24810989, 24882516, 24993351, 24993889, 25087979, 25109451, 25218593, 25492965, 25605020, 25607725, 25670202, 25701461, 25743273, 25782587, 25832504, 25846731, 25893606, 26126522, 26239136, 26263504, 26316081, 26364597, 26389641, 26440309, 26443705, 26496700, 26750334, 26758663, 27013234, 27321186, 27325246, 27566107, 27601049, 27605415, 27705928, 27835600, 27864128, 28036290, 28076850, 28123852, 28368398, 28454447, 28460446, 28504812, 28645247, 28682834, 28720576, 28809862, 28887324, 28905448, 28943922, 28962129, 28962630, 29061667, 29079722, 29088716, 29088741, 29113304, 29163769, 29167315, 29179447, 29208682, 29259017, 29296212, 29316250, 29396428, 29438698, 29449692, 29452146, 29490948, 29505957, 29507618, 29541248, 29587800, 29598951, 29770434, 29844307, 29850494, 29887596, 29895829, 29907586, 29914241, 29920228, 29930727, 29970036, 29985391, 30006603, 30037824, 30055645, 30068939, 30074279, 30078391, 30099342, 30206136, 30231971, 30353028, 30396386, 30400241, 30466467, 30527180, 30574018, 30599110, 30678988, 30794805, 30794807, 30833665, 30868052, 30903103, 30907227, 30934860, 30979377, 31085100, 31100813, 31142482, 31241783, 31270418, 31308079, 31352078, 31391070, 31477715, 31530502, 31537895, 31575084, 31619268, 31633304, 31754005, 31766357		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	CTD_human_DG	27935819		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	CTD_human_DG	26121086		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	Pubtator	31003773, 31672841, 31863533, 36121500, 36882436	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	BEFREE	31672841		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	27935819		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	27418196		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	18725387, 26923924, 28468780		★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	33872989	Associate	★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	26070409, 31358770		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16872493, 23928732, 25754111, 26316081, 26716514, 27223073, 27231341, 27418196, 27500472, 27903989, 28376152, 28468127, 29286919, 29435131, 29487002, 29700328, 29888108, 29989053, 30389502, 30685130, 30964169, 30988063, 31008931, 31096145, 31766357, 31818312		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	26070409		★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29079305		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	35182054	Associate	★☆☆☆☆ Found in Text Mining only
Ocular Hypertension	Ocular hypertension	Pubtator	29677358	Associate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	29781562		★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic Atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Optic Atrophy 1	Optic Atrophy	BEFREE	30537740		★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	31397922		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	35168589, 36368426	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	30629753		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	38169377	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	23527718, 24993351, 25832504, 26028530, 28905448, 29257207, 29597092, 30182452, 30317613, 30514309, 31006663, 31376525, 31542501		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	23527718, 26028530, 27206784, 27608849, 30926223, 31006663, 31542501, 33431791, 34697383, 35284040, 35705143, 36931102, 38071381	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	18703216, 28339095, 35173533	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	20947521		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	24511017, 25369529, 26804165, 27321186, 28339095, 28698296		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	21909427, 24511017, 26119935, 26364602, 30485824, 30759370, 32433460, 32918541, 33537822, 33576454, 34132072, 35053353, 36345952, 36804120, 37709768, 37828220	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23949920, 35092398	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Serous Adenocarcinoma	Ovarian serous adenocarcinoma	BEFREE	27321186		★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	30302800		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	16596258, 26440309, 28099921, 28253715, 28259973, 28381547, 28475017, 28576749, 28962129, 29587800, 29599309, 30056064, 31383722, 31452251, 31518341, 31558702, 31562256, 31575084, 31810603		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	16596258, 28002618, 28099921, 28475017, 29587800, 31557131, 31831555, 31849712		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	22396793, 27669292, 27738325, 28360038, 28475017, 29183995, 29510195, 30072378, 31253872, 31358620, 32054505, 32203889, 33416116, 33501895, 34257617, 34644566, 34958764, 35271750, 36536047, 37096681, 37318258, 39647834, 39903418	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	27764193, 30404014		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	35703534	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	16596258, 28697132		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	28036290, 28682834, 30237435		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	31522174		★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid neoplasm	Pubtator	33670622	Inhibit	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	36716535	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	33968042	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	30629753		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	36055128	Associate	★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	38226984	Associate	★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	35269556	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	29891559		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	29891559		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	22499345, 26416764, 28079802, 28195137, 28961951		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	GWASDB_DG	22885925		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	GWASCAT_DG	22885925, 26416764, 30566500		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	25904635, 26416764, 28079802, 32289280, 37223019	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Poroma	Poroma	BEFREE	31145701		★☆☆☆☆ Found in Text Mining only
Posterior embryotoxon	Posterior embryotoxon	HPO_DG			★☆☆☆☆ Found in Text Mining only
Primary malignant neoplasm of brain	Brain Neoplasms	CTD_human_DG	27935819		★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	30289073		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	21278236, 26126522, 26701088, 26731476, 27270433, 27832783, 28052036, 29185453, 29372107, 29383141, 30859486		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	26058078, 26701088, 26731476, 27109047, 27555231		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26126522, 27109047, 29143545, 30859486, 31387394, 32205868, 32376689, 32488048, 32633347, 33897882, 35562348, 36254631, 36754848, 37385752, 38246916	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	35092398	Stimulate	★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29642520, 30644438		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	29241219		★☆☆☆☆ Found in Text Mining only
Recurrent Brain Neoplasm	Brain Neoplasms	CTD_human_DG	27935819		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29930727, 31179326		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	28739802, 31825843		★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	28400537		★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal Detachment	HPO_DG			★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	37964544	Inhibit	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	26496700, 28923841, 30353028		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	28923841, 29596030	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Embryonal	Rhabdomyosarcoma	Pubtator	28923841	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	30808624		★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	25388162	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	20842732, 25087979, 26050962, 27129148, 29490948, 30167083, 30333301, 30382078, 31112524		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	26080399, 27129148, 29104083, 31880317, 32461620, 35546636	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	21170084, 28671673, 31880317, 40414844	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	36920288	Associate	★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	25388162		★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	27807512	Associate	★☆☆☆☆ Found in Text Mining only
Serous cystadenocarcinoma ovary	Ovarian Serous Cystadenocarcinoma	BEFREE	28339095		★☆☆☆☆ Found in Text Mining only
Sinusitis	Sinusitis	Pubtator	37382248	Associate	★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	26989177		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	21118971, 27418196, 29088741, 30926931, 31692299		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	27627196, 33011388, 33086069, 33899786, 34364705, 35789143, 35838343, 36149789, 36378541, 36399634, 36399951, 37752152, 39283755, 40649874	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	21610251, 23422184, 24292195, 25115923, 25782587, 25794680, 26239136, 27907036, 28041841, 28177901, 28874669, 28923839, 29088716, 29875149, 30231971		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	21112960, 21289630, 24621512, 29403552, 30401982, 30539010, 30599110, 31560173, 31851786		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	20729916, 22096589, 28535002, 29262850, 29985391, 30907227, 31422218, 31869662, 32985688, 32990596, 33786612, 35705032, 36288272, 37986681, 40243891	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31217745, 34997070	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	28916653		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	27013234, 30231971, 30931936		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	CTD_human_DG	20729916		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	24993889, 28041841, 29262850, 29340043, 29598951, 29985391, 31413738, 31817001		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	21346147, 24175801, 24325916, 24525233, 25846731, 27835600, 28381174, 28885730, 29113304, 29296196, 29367737, 29535422, 29669762, 30134988, 30297104, 30349368, 30934860, 31175271, 31632054, 31796534		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	19705503, 23058008, 23298488, 24175801, 24643316, 25846731, 26823784, 27325246, 29136404, 29402328, 29436693, 30066917, 30180862, 31378888, 31827075, 32160412, 32227453, 32271880, 33654199, 34075691, 34650666, 35017464, 35664988, 35996148, 36803368, 36838824, 37806457, 37950040, 37950281, 38041813	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28381174	Stimulate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	29669762		★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28756200		★☆☆☆☆ Found in Text Mining only
Subfertility	Subfertility	BEFREE	31199671		★☆☆☆☆ Found in Text Mining only
Sveinsson Chorioretinal Atrophy	Sveinsson chorioretinal atrophy	Pubtator	23029054	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	23685355	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	24810989, 26359368, 27753655, 29762852, 29845281		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	36813921	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	24810989, 27753655, 29845281		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	24810989, 27556512, 29762852	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	25031743	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	25344213, 27039292, 27658423, 28248929, 30250159, 31235595, 31817810, 32325700, 32462982, 33587979, 34168046, 34449481, 34725332, 35102250, 35459269, 36581998, 36633714, 36738577, 37770435, 38164185	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29228705, 29316250, 29758456, 30092563, 30467925, 30678988, 31235595, 31308079, 31590917		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	CTD_human_DG	30703373		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35817390, 36280829	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	BEFREE	29396428		★☆☆☆☆ Found in Text Mining only
Urethral Obstruction	Urethral obstruction	Pubtator	36069177	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	23870412, 26119935, 29248722, 30668336, 31207288, 31789387, 32596945, 35358000, 35665684, 36385700, 37039264	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	29725256	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	25304677	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23502453, 24810989, 25304677, 30344797, 32555725, 32945353, 34994156, 36195847, 38250152, 38307027	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	40702758	Associate	★☆☆☆☆ Found in Text Mining only
Uveal coloboma-cleft lip and palate-intellectual disability	Ocular Coloboma, With Or Without Hearing Impairment, Cleft Lip/Palate, And/Or Mental Retardation	Orphanet			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Uveal melanoma	Uveal Melanoma	BEFREE	24882515, 24882516, 24937456, 25526026, 29570931, 31801083		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	32277165, 33798262, 35332245, 37467061	Associate	★☆☆☆☆ Found in Text Mining only
Vacuolar myopathy	Vacuolar myopathy	Pubtator	35054765	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	30388809	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	BEFREE	26426694		★☆☆☆☆ Found in Text Mining only
Warburg Sjo Fledelius syndrome	Warburg micro syndrome	Pubtator	27807512	Associate	★☆☆☆☆ Found in Text Mining only