Gene Gene information from NCBI Gene database.
Entrez ID 10403
Gene name NDC80 kinetochore complex component
Gene symbol NDC80
Synonyms (NCBI Gene)
HECHEC1HsHec1KNTC2TID3hsNDC80
Chromosome 18
Chromosome location 18p11.32
Summary This gene encodes a component of the NDC80 kinetochore complex. The encoded protein consists of an N-terminal microtubule binding domain and a C-terminal coiled-coiled domain that interacts with other components of the complex. This protein functions to o
miRNA miRNA information provided by mirtarbase database.
5
miRTarBase ID miRNA Experiments Reference
MIRT016353 hsa-miR-193b-3p Microarray 20304954
MIRT1177859 hsa-miR-1246 CLIP-seq
MIRT1177860 hsa-miR-3201 CLIP-seq
MIRT1177861 hsa-miR-4791 CLIP-seq
MIRT1177862 hsa-miR-590-3p CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Transcription factor Regulation Reference
ATF4 Activation 17822787
CREB1 Activation 17822787
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
53
GO ID Ontology Definition Evidence Reference
GO:0000070 Process Mitotic sister chromatid segregation TAS 9315664
GO:0000132 Process Establishment of mitotic spindle orientation IMP 19468067
GO:0000278 Process Mitotic cell cycle TAS 9315664
GO:0000280 Process Nuclear division IEA
GO:0000775 Component Chromosome, centromeric region IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607272 16909 ENSG00000080986
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O14777
Protein name Kinetochore protein NDC80 homolog (Highly expressed in cancer protein) (Kinetochore protein Hec1) (HsHec1) (Kinetochore-associated protein 2) (Retinoblastoma-associated protein HEC)
Protein function Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity (PubMed:12351790, PubMed:14654001, PubMed:14699129, PubMed:15062103, PubMed:15235793, PubMed:
PDB 2IGP , 2VE7 , 3IZ0 , 8G0P
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03801 Ndc80_HEC 51 206 HEC/Ndc80p family Family
PF18077 DUF5595 213 285 Domain of unknown function (DUF5595) Domain
Sequence
MKRSSVSSGGAGRLSMQELRSQDVNKQGLYTPQTKEKPTFGKLSINKPTSERKVSLFGKR
TSGHGSRNSQLGIFSSSEKIKDPRPLNDKAFIQQCIRQLCEFLTENGYAHNVSMKSLQAP
SVKDFLKIFTFLYGFLCPSYELPDTKFEEEVPRIFKDLGYPFALSKSSMYTVGAPHTWPH
IVAALVWLIDCIKIHTAMKESSPLFD
DGQPWGEETEDGIMHNKLFLDYTIKCYESFMSGA
DSFDEMNAELQSKLKDLFNVDAFKLESLEAKNRALNEQIARLEQE
REKEPNRLESLRKLK
ASLQGDVQKYQAYMSNLESHSAILDQKLNGLNEEIARVELECETIKQENTRLQNIIDNQK
YSVADIERINHERNELQQTINKLTKDLEAEQQKLWNEELKYARGKEAIETQLAEYHKLAR
KLKLIPKGAENSKGYDFEIKFNPEAGANCLVKYRAQVYVPLKELLNETEEEINKALNKKM
GLEDTLEQLNAMITESKRSVRTLKEEVQKLDDLYQQKIKEAEEEDEKCASELESLEKHKH
LLESTVNQGLSEAMNELDAVQREYQLVVQTTTEERRKVGNNLQRLLEMVATHVGSVEKHL
EEQIAKVDREYEECMSEDLSENIKEIRDKYEKKATLIKSSEE
Sequence length 642
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cell cycle   Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
Separation of Sister Chromatids
Resolution of Sister Chromatid Cohesion
RHO GTPases Activate Formins
Mitotic Prometaphase
EML4 and NUDC in mitotic spindle formation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CARCINOMA, HEPATOCELLULAR CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma Adenocarcinoma BEFREE 22923148, 29595187, 31652494
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma, Endometrioid Endometrial Cancer BEFREE 20372780, 23967051
★☆☆☆☆
Found in Text Mining only
Adenomatous Polyposis Coli Multiple polyposis syndrome BEFREE 12097272
★☆☆☆☆
Found in Text Mining only
Adrenocortical Carcinoma Adrenocortical carcinoma Pubtator 35983531 Associate
★☆☆☆☆
Found in Text Mining only
Atypical Endometrial Hyperplasia Endometrial Hyperplasia BEFREE 12373298
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 24662830, 24694948, 29100415, 29736203, 30963213, 8798658
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 21352579, 29693125, 31198978, 35456460 Associate
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 28611520 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Carcinoma BEFREE 14697335
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 28611520, 33102593, 33109182, 33688500, 34746301, 36317111 Associate
★☆☆☆☆
Found in Text Mining only