Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10402
Gene name	ST3 beta-galactoside alpha-2,3-sialyltransferase 6
Gene symbol	ST3GAL6
Synonyms (NCBI Gene)	SIAT10ST3GALVI
Chromosome	3
Chromosome location	3q12.1
Summary	The protein encoded by this gene is a member of the sialyltransferase family. Members of this family are enzymes that transfer sialic acid from the activated cytidine 5`-monophospho-N-acetylneuraminic acid to terminal positions on sialylated glycolipids (

Show/Hide all (55)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024498	hsa-miR-215-5p	Microarray	19074876
MIRT026490	hsa-miR-192-5p	Microarray	19074876
MIRT649450	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT649448	hsa-miR-1248	HITS-CLIP	23824327
MIRT649447	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT649446	hsa-miR-526b-5p	HITS-CLIP	23824327
MIRT649450	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT649448	hsa-miR-1248	HITS-CLIP	23824327
MIRT649447	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT649446	hsa-miR-526b-5p	HITS-CLIP	23824327
MIRT1393586	hsa-miR-138	CLIP-seq
MIRT1393587	hsa-miR-3182	CLIP-seq
MIRT1393588	hsa-miR-320e	CLIP-seq
MIRT1393589	hsa-miR-323-5p	CLIP-seq
MIRT1393590	hsa-miR-4303	CLIP-seq
MIRT1393591	hsa-miR-4456	CLIP-seq
MIRT1393592	hsa-miR-4682	CLIP-seq
MIRT1393593	hsa-miR-627	CLIP-seq
MIRT1393594	hsa-miR-876-3p	CLIP-seq
MIRT1393595	hsa-miR-924	CLIP-seq
MIRT2118131	hsa-miR-101	CLIP-seq
MIRT2118132	hsa-miR-144	CLIP-seq
MIRT2118133	hsa-miR-4662a-5p	CLIP-seq
MIRT2118134	hsa-miR-4716-5p	CLIP-seq
MIRT2118135	hsa-miR-582-5p	CLIP-seq
MIRT2118131	hsa-miR-101	CLIP-seq
MIRT2340114	hsa-miR-1226	CLIP-seq
MIRT2340115	hsa-miR-1324	CLIP-seq
MIRT1393586	hsa-miR-138	CLIP-seq
MIRT2118132	hsa-miR-144	CLIP-seq
MIRT2340116	hsa-miR-27a	CLIP-seq
MIRT2340117	hsa-miR-27b	CLIP-seq
MIRT1393588	hsa-miR-320e	CLIP-seq
MIRT1393589	hsa-miR-323-5p	CLIP-seq
MIRT1393591	hsa-miR-4456	CLIP-seq
MIRT2340118	hsa-miR-4514	CLIP-seq
MIRT2340119	hsa-miR-4645-3p	CLIP-seq
MIRT2340120	hsa-miR-4645-5p	CLIP-seq
MIRT2118133	hsa-miR-4662a-5p	CLIP-seq
MIRT2340121	hsa-miR-4673	CLIP-seq
MIRT2340122	hsa-miR-4692	CLIP-seq
MIRT2118134	hsa-miR-4716-5p	CLIP-seq
MIRT2340123	hsa-miR-4733-3p	CLIP-seq
MIRT2340124	hsa-miR-513a-5p	CLIP-seq
MIRT2118135	hsa-miR-582-5p	CLIP-seq
MIRT1393594	hsa-miR-876-3p	CLIP-seq
MIRT2460595	hsa-miR-1323	CLIP-seq
MIRT2460596	hsa-miR-548ac	CLIP-seq
MIRT2460597	hsa-miR-548ae	CLIP-seq
MIRT2460598	hsa-miR-548aj	CLIP-seq
MIRT2460599	hsa-miR-548am	CLIP-seq
MIRT2460600	hsa-miR-548d-3p	CLIP-seq
MIRT2460601	hsa-miR-548o	CLIP-seq
MIRT2460602	hsa-miR-548x	CLIP-seq
MIRT2460603	hsa-miR-548z	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0003836	Function	Beta-galactoside (CMP) alpha-2,3-sialyltransferase activity	TAS
GO:0005794	Component	Golgi apparatus	IEA
GO:0006486	Process	Protein glycosylation	IBA
GO:0006486	Process	Protein glycosylation	IDA	10206952
GO:0006486	Process	Protein glycosylation	IEA
GO:0008118	Function	N-acetyllactosaminide alpha-2,3-sialyltransferase activity	IDA	10206952
GO:0008118	Function	N-acetyllactosaminide alpha-2,3-sialyltransferase activity	IEA
GO:0008373	Function	Sialyltransferase activity	IBA
GO:0008373	Function	Sialyltransferase activity	IEA
GO:0009247	Process	Glycolipid biosynthetic process	IBA
GO:0009247	Process	Glycolipid biosynthetic process	IDA	10206952
GO:0009312	Process	Oligosaccharide biosynthetic process	TAS
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	10206952
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0018146	Process	Keratan sulfate proteoglycan biosynthetic process	TAS
GO:0070062	Component	Extracellular exosome	HDA	19199708, 23533145
GO:0071354	Process	Cellular response to interleukin-6	IEP	17944600

MIM	HGNC	e!Ensembl
607156	18080	ENSG00000064225

Q9Y274

Protein name

Type 2 lactosamine alpha-2,3-sialyltransferase (EC 2.4.3.6) (CMP-NeuAc:beta-galactoside alpha-2,3-sialyltransferase VI) (ST3Gal VI) (ST3GalVI) (Sialyltransferase 10)

Protein function

Transfers the sialyl residue from CMP-N-acetyl-beta-neuraminate to the terminal galactose residue on sugar chains of glycoproteins and glycolipids (PubMed:10206952, PubMed:26692484). It's alpha-2,3-sialyltransferase activity is specific toward t

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00777	Glyco_transf_29	62 → 329	Glycosyltransferase family 29 (sialyltransferase)	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous.

Sequence

MRGYLVAIFLSAVFLYYVLHCILWGTNVYWVAPVEMKRRNKIQPCLSKPAFASLLRFHQF
HPFLCAADFRKIASLYGSDKFDLPYGMRTSAEYFRLALSKLQSCDLFDEFDNIPCKKCVV
VGNGGVLKNKTLGEKIDSYDVIIRMNNGPVLGHEEEVGRRTTFRLFYPESVFSDPIHNDP
NTTVILTAFKPHDLRWLLELLMGDKINTNGFWKKPALNLIYKPYQIRILDPFIIRTAAYE
LLHFPKVFPKNQKPKHPTTGIIAITLAFYICHEVHLAGFKYNFSDLKSPLHYYGNATMSL
MNKNAYHNVTAEQLFLKDIIEKNLVINLTQD

Sequence length

331

Interactions

View interactions

	KEGG		Reactome
	Glycosphingolipid biosynthesis - lacto and neolacto series Metabolic pathways		Keratan sulfate biosynthesis Sialic acid metabolism Lewis blood group biosynthesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BASAL CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (17)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	31257275	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic lateral sclerosis 1	Amyotrophic lateral sclerosis	Pubtator	31257275	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	26367242	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27993161	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	18485915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23471507, 30613961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21147760, 27906498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	31509989	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10206952	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	25061176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	29459023	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	33649796	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21147760, 22025563, 25061176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	37434153	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	18485915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29894296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	32929335	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ST3GAL6 (ST3 beta-galactoside alpha-2,3-sialyltransferase 6)