Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10401
Gene name	Protein inhibitor of activated STAT 3
Gene symbol	PIAS3
Synonyms (NCBI Gene)	ZMIZ5
Chromosome	1
Chromosome location	1q21.1
Summary	This gene encodes a member of the PIAS [protein inhibitor of activated STAT (signal transducer and activator of transcription)] family of transcriptional modulators. The protein functions as a SUMO (small ubiquitin-like modifier)-E3 ligase which catalyzes

227

Show/Hide all (227)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006288	hsa-miR-21-5p	Luciferase reporter assay	22316494
MIRT006288	hsa-miR-21-5p	Luciferase reporter assay	22316494
MIRT006288	hsa-miR-21-5p	Luciferase reporter assay	22316494
MIRT006288	hsa-miR-21-5p	Luciferase reporter assay	22316494
MIRT006288	hsa-miR-21-5p	Luciferase reporter assay	22316494
MIRT006288	hsa-miR-21-5p	Luciferase reporter assay	22316494
MIRT047704	hsa-miR-10a-5p	CLASH	23622248
MIRT053024	hsa-miR-18a-5p	ImmunohistochemistryIn situ hybridizationLuciferase reporter assayqRT-PCR	23322197
MIRT053294	hsa-miR-125b-5p	Luciferase reporter assayWestern blot	23857508
MIRT053024	hsa-miR-18a-5p	ImmunohistochemistryIn situ hybridizationLuciferase reporter assayqRT-PCR	23322197
MIRT006288	hsa-miR-21-5p	ELISAqRT-PCRWestern blot	23998932
MIRT006288	hsa-miR-21-5p	ELISAqRT-PCRWestern blot	23998932
MIRT1232893	hsa-miR-1225-3p	CLIP-seq
MIRT1232894	hsa-miR-1231	CLIP-seq
MIRT1232895	hsa-miR-1262	CLIP-seq
MIRT1232896	hsa-miR-1291	CLIP-seq
MIRT1232897	hsa-miR-181a	CLIP-seq
MIRT1232898	hsa-miR-181b	CLIP-seq
MIRT1232899	hsa-miR-181c	CLIP-seq
MIRT1232900	hsa-miR-181d	CLIP-seq
MIRT1232901	hsa-miR-185	CLIP-seq
MIRT1232902	hsa-miR-18a	CLIP-seq
MIRT1232903	hsa-miR-18b	CLIP-seq
MIRT1232904	hsa-miR-298	CLIP-seq
MIRT1232905	hsa-miR-3115	CLIP-seq
MIRT1232906	hsa-miR-3120-5p	CLIP-seq
MIRT1232907	hsa-miR-3170	CLIP-seq
MIRT1232908	hsa-miR-3176	CLIP-seq
MIRT1232909	hsa-miR-3187-3p	CLIP-seq
MIRT1232910	hsa-miR-328	CLIP-seq
MIRT1232911	hsa-miR-335	CLIP-seq
MIRT1232912	hsa-miR-3918	CLIP-seq
MIRT1232913	hsa-miR-3922-3p	CLIP-seq
MIRT1232914	hsa-miR-3943	CLIP-seq
MIRT1232915	hsa-miR-410	CLIP-seq
MIRT1232916	hsa-miR-4260	CLIP-seq
MIRT1232917	hsa-miR-4262	CLIP-seq
MIRT1232918	hsa-miR-4278	CLIP-seq
MIRT1232919	hsa-miR-4282	CLIP-seq
MIRT1232920	hsa-miR-4306	CLIP-seq
MIRT1232921	hsa-miR-4435	CLIP-seq
MIRT1232922	hsa-miR-4644	CLIP-seq
MIRT1232923	hsa-miR-4650-5p	CLIP-seq
MIRT1232924	hsa-miR-4694-3p	CLIP-seq
MIRT1232925	hsa-miR-4701-3p	CLIP-seq
MIRT1232926	hsa-miR-4701-5p	CLIP-seq
MIRT1232927	hsa-miR-4716-3p	CLIP-seq
MIRT1232928	hsa-miR-4735-3p	CLIP-seq
MIRT1232929	hsa-miR-4749-3p	CLIP-seq
MIRT1232930	hsa-miR-4755-3p	CLIP-seq
MIRT1232931	hsa-miR-4761-5p	CLIP-seq
MIRT1232932	hsa-miR-4795-3p	CLIP-seq
MIRT1232933	hsa-miR-513b	CLIP-seq
MIRT1232934	hsa-miR-522	CLIP-seq
MIRT1232935	hsa-miR-543	CLIP-seq
MIRT1232936	hsa-miR-548a-5p	CLIP-seq
MIRT1232937	hsa-miR-548ab	CLIP-seq
MIRT1232938	hsa-miR-548ak	CLIP-seq
MIRT1232939	hsa-miR-548b-5p	CLIP-seq
MIRT1232940	hsa-miR-548c-5p	CLIP-seq
MIRT1232941	hsa-miR-548d-5p	CLIP-seq
MIRT1232942	hsa-miR-548h	CLIP-seq
MIRT1232943	hsa-miR-548i	CLIP-seq
MIRT1232944	hsa-miR-548j	CLIP-seq
MIRT1232945	hsa-miR-548n	CLIP-seq
MIRT1232946	hsa-miR-548s	CLIP-seq
MIRT1232947	hsa-miR-548w	CLIP-seq
MIRT1232948	hsa-miR-548y	CLIP-seq
MIRT1232949	hsa-miR-559	CLIP-seq
MIRT1232950	hsa-miR-588	CLIP-seq
MIRT1232951	hsa-miR-606	CLIP-seq
MIRT1232952	hsa-miR-625	CLIP-seq
MIRT1552304	hsa-miR-1275	CLIP-seq
MIRT1552305	hsa-miR-2277-3p	CLIP-seq
MIRT1552306	hsa-miR-3147	CLIP-seq
MIRT1552307	hsa-miR-4302	CLIP-seq
MIRT1552308	hsa-miR-4425	CLIP-seq
MIRT1552309	hsa-miR-4525	CLIP-seq
MIRT1552310	hsa-miR-4665-5p	CLIP-seq
MIRT1552311	hsa-miR-4723-5p	CLIP-seq
MIRT1232952	hsa-miR-625	CLIP-seq
MIRT2068506	hsa-miR-1	CLIP-seq
MIRT2068507	hsa-miR-1178	CLIP-seq
MIRT2068508	hsa-miR-1207-5p	CLIP-seq
MIRT2068509	hsa-miR-1227	CLIP-seq
MIRT2068510	hsa-miR-1243	CLIP-seq
MIRT2068511	hsa-miR-1245b-5p	CLIP-seq
MIRT1552304	hsa-miR-1275	CLIP-seq
MIRT2068512	hsa-miR-129-3p	CLIP-seq
MIRT2068513	hsa-miR-1302	CLIP-seq
MIRT2068514	hsa-miR-1827	CLIP-seq
MIRT2068515	hsa-miR-1909	CLIP-seq
MIRT2068516	hsa-miR-206	CLIP-seq
MIRT1552305	hsa-miR-2277-3p	CLIP-seq
MIRT1232906	hsa-miR-3120-5p	CLIP-seq
MIRT2068517	hsa-miR-3122	CLIP-seq
MIRT2068518	hsa-miR-3142	CLIP-seq
MIRT2068519	hsa-miR-3143	CLIP-seq
MIRT1552306	hsa-miR-3147	CLIP-seq
MIRT2068520	hsa-miR-3157-5p	CLIP-seq
MIRT1232908	hsa-miR-3176	CLIP-seq
MIRT2068521	hsa-miR-3199	CLIP-seq
MIRT2068522	hsa-miR-3612	CLIP-seq
MIRT2068523	hsa-miR-3654	CLIP-seq
MIRT2068524	hsa-miR-3692	CLIP-seq
MIRT2068525	hsa-miR-3913-5p	CLIP-seq
MIRT1232913	hsa-miR-3922-3p	CLIP-seq
MIRT2068526	hsa-miR-4264	CLIP-seq
MIRT2068527	hsa-miR-4266	CLIP-seq
MIRT2068528	hsa-miR-4271	CLIP-seq
MIRT2068529	hsa-miR-4279	CLIP-seq
MIRT2068530	hsa-miR-4293	CLIP-seq
MIRT2068531	hsa-miR-4298	CLIP-seq
MIRT1552307	hsa-miR-4302	CLIP-seq
MIRT2068532	hsa-miR-4312	CLIP-seq
MIRT2068533	hsa-miR-4328	CLIP-seq
MIRT2068534	hsa-miR-4421	CLIP-seq
MIRT1552308	hsa-miR-4425	CLIP-seq
MIRT1552309	hsa-miR-4525	CLIP-seq
MIRT2068535	hsa-miR-455-5p	CLIP-seq
MIRT1552310	hsa-miR-4665-5p	CLIP-seq
MIRT2068536	hsa-miR-4690-3p	CLIP-seq
MIRT2068537	hsa-miR-4695-5p	CLIP-seq
MIRT1552311	hsa-miR-4723-5p	CLIP-seq
MIRT2068538	hsa-miR-4725-3p	CLIP-seq
MIRT2068539	hsa-miR-4763-3p	CLIP-seq
MIRT2068540	hsa-miR-4779	CLIP-seq
MIRT2068541	hsa-miR-4797-3p	CLIP-seq
MIRT2068542	hsa-miR-4803	CLIP-seq
MIRT2068543	hsa-miR-587	CLIP-seq
MIRT2068544	hsa-miR-613	CLIP-seq
MIRT1232952	hsa-miR-625	CLIP-seq
MIRT2068545	hsa-miR-650	CLIP-seq
MIRT2068546	hsa-miR-940	CLIP-seq
MIRT2068507	hsa-miR-1178	CLIP-seq
MIRT1232893	hsa-miR-1225-3p	CLIP-seq
MIRT1232895	hsa-miR-1262	CLIP-seq
MIRT2068513	hsa-miR-1302	CLIP-seq
MIRT1232897	hsa-miR-181a	CLIP-seq
MIRT1232898	hsa-miR-181b	CLIP-seq
MIRT1232899	hsa-miR-181c	CLIP-seq
MIRT1232900	hsa-miR-181d	CLIP-seq
MIRT1552305	hsa-miR-2277-3p	CLIP-seq
MIRT1232905	hsa-miR-3115	CLIP-seq
MIRT2068517	hsa-miR-3122	CLIP-seq
MIRT1232907	hsa-miR-3170	CLIP-seq
MIRT1232909	hsa-miR-3187-3p	CLIP-seq
MIRT2068521	hsa-miR-3199	CLIP-seq
MIRT2295676	hsa-miR-345	CLIP-seq
MIRT2295677	hsa-miR-361-3p	CLIP-seq
MIRT2295678	hsa-miR-383	CLIP-seq
MIRT2068525	hsa-miR-3913-5p	CLIP-seq
MIRT1232914	hsa-miR-3943	CLIP-seq
MIRT1232917	hsa-miR-4262	CLIP-seq
MIRT2068531	hsa-miR-4298	CLIP-seq
MIRT1552307	hsa-miR-4302	CLIP-seq
MIRT1552308	hsa-miR-4425	CLIP-seq
MIRT1232921	hsa-miR-4435	CLIP-seq
MIRT1232925	hsa-miR-4701-3p	CLIP-seq
MIRT1232926	hsa-miR-4701-5p	CLIP-seq
MIRT2295679	hsa-miR-4731-5p	CLIP-seq
MIRT1232932	hsa-miR-4795-3p	CLIP-seq
MIRT1232933	hsa-miR-513b	CLIP-seq
MIRT1232935	hsa-miR-543	CLIP-seq
MIRT1232946	hsa-miR-548s	CLIP-seq
MIRT2068543	hsa-miR-587	CLIP-seq
MIRT1232950	hsa-miR-588	CLIP-seq
MIRT1232952	hsa-miR-625	CLIP-seq
MIRT2295680	hsa-miR-759	CLIP-seq
MIRT2068508	hsa-miR-1207-5p	CLIP-seq
MIRT2068510	hsa-miR-1243	CLIP-seq
MIRT2068511	hsa-miR-1245b-5p	CLIP-seq
MIRT2068514	hsa-miR-1827	CLIP-seq
MIRT2068515	hsa-miR-1909	CLIP-seq
MIRT2593484	hsa-miR-2681	CLIP-seq
MIRT2068518	hsa-miR-3142	CLIP-seq
MIRT2593485	hsa-miR-3158-5p	CLIP-seq
MIRT2593486	hsa-miR-3198	CLIP-seq
MIRT2068522	hsa-miR-3612	CLIP-seq
MIRT2068523	hsa-miR-3654	CLIP-seq
MIRT2593487	hsa-miR-3924	CLIP-seq
MIRT2068527	hsa-miR-4266	CLIP-seq
MIRT2068528	hsa-miR-4271	CLIP-seq
MIRT2593488	hsa-miR-4309	CLIP-seq
MIRT2068537	hsa-miR-4695-5p	CLIP-seq
MIRT2068538	hsa-miR-4725-3p	CLIP-seq
MIRT2593489	hsa-miR-4753-5p	CLIP-seq
MIRT2068539	hsa-miR-4763-3p	CLIP-seq
MIRT2068540	hsa-miR-4779	CLIP-seq
MIRT2593490	hsa-miR-496	CLIP-seq
MIRT2068545	hsa-miR-650	CLIP-seq
MIRT2593491	hsa-miR-659	CLIP-seq
MIRT2593492	hsa-miR-9	CLIP-seq
MIRT2068546	hsa-miR-940	CLIP-seq
MIRT2068508	hsa-miR-1207-5p	CLIP-seq
MIRT2068510	hsa-miR-1243	CLIP-seq
MIRT2068511	hsa-miR-1245b-5p	CLIP-seq
MIRT2068514	hsa-miR-1827	CLIP-seq
MIRT2687860	hsa-miR-186	CLIP-seq
MIRT2068515	hsa-miR-1909	CLIP-seq
MIRT2593484	hsa-miR-2681	CLIP-seq
MIRT2687861	hsa-miR-3133	CLIP-seq
MIRT2068518	hsa-miR-3142	CLIP-seq
MIRT2593485	hsa-miR-3158-5p	CLIP-seq
MIRT2687862	hsa-miR-3180-5p	CLIP-seq
MIRT2593486	hsa-miR-3198	CLIP-seq
MIRT2068522	hsa-miR-3612	CLIP-seq
MIRT2068523	hsa-miR-3654	CLIP-seq
MIRT2593487	hsa-miR-3924	CLIP-seq
MIRT2068527	hsa-miR-4266	CLIP-seq
MIRT2068528	hsa-miR-4271	CLIP-seq
MIRT2593488	hsa-miR-4309	CLIP-seq
MIRT2687863	hsa-miR-4509	CLIP-seq
MIRT2068537	hsa-miR-4695-5p	CLIP-seq
MIRT2687864	hsa-miR-4715-3p	CLIP-seq
MIRT2068538	hsa-miR-4725-3p	CLIP-seq
MIRT2687865	hsa-miR-4744	CLIP-seq
MIRT2593489	hsa-miR-4753-5p	CLIP-seq
MIRT2068539	hsa-miR-4763-3p	CLIP-seq
MIRT2068540	hsa-miR-4779	CLIP-seq
MIRT2593490	hsa-miR-496	CLIP-seq
MIRT2687866	hsa-miR-520a-5p	CLIP-seq
MIRT2687867	hsa-miR-525-5p	CLIP-seq
MIRT2068545	hsa-miR-650	CLIP-seq
MIRT2593491	hsa-miR-659	CLIP-seq
MIRT2593492	hsa-miR-9	CLIP-seq
MIRT2068546	hsa-miR-940	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
STAT3	Activation	14630083
TP53	Repression	11877452

Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	IBA
GO:0003712	Function	Transcription coregulator activity	IBA
GO:0005515	Function	Protein binding	IPI	11060035, 14715251, 17087506, 21965678, 28842558, 32296183, 32814053, 35512704
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010803	Process	Regulation of tumor necrosis factor-mediated signaling pathway	IEA
GO:0016607	Component	Nuclear speck	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016925	Process	Protein sumoylation	IBA
GO:0016925	Process	Protein sumoylation	IEA
GO:0016925	Process	Protein sumoylation	IEA
GO:0016925	Process	Protein sumoylation	ISS
GO:0016925	Process	Protein sumoylation	TAS
GO:0019789	Function	SUMO transferase activity	EXP	15507434, 19041634, 21965678
GO:0019789	Function	SUMO transferase activity	IEA
GO:0019789	Function	SUMO transferase activity	TAS
GO:0033234	Process	Negative regulation of protein sumoylation	IDA	24651376
GO:0033235	Process	Positive regulation of protein sumoylation	IDA	17696781, 21965678
GO:0045671	Process	Negative regulation of osteoclast differentiation	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0060255	Process	Regulation of macromolecule metabolic process	IEA
GO:0061665	Function	SUMO ligase activity	IBA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099523	Component	Presynaptic cytosol	IEA
GO:0099524	Component	Postsynaptic cytosol	IEA

MIM	HGNC	e!Ensembl
605987	16861	ENSG00000131788

Q9Y6X2

Protein name

E3 SUMO-protein ligase PIAS3 (EC 2.3.2.-) (E3 SUMO-protein transferase PIAS3) (Protein inhibitor of activated STAT protein 3)

Protein function

Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. Plays a crucial role as a transcriptional coregulation in various cellular pathways

PDB

4MVT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14324	PINIT	126 → 278	PINIT domain	Domain
PF02891	zf-MIZ	323 → 372	MIZ/SP-RING zinc finger	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:9388184}.

Sequence

MAELGELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKEL
YRRRFPRKTLGPSDLSLLSLPPGTSPVGSPGPLAPIPPTLLAPGTLLGPKREVDMHPPLP
QPVHPDVTMKPLPFYEVYGELIRPTTLASTSSQRFEEAHFTFALTPQQVQQILTSREVLP
GAKCDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYLPPTKNGAEPKRPSR
PINITPLARLSATVPNTIVVNWSSEFGRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHS
RALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEK
KPTWTCPVCDKKAPYESLIIDGLFMEILSSCSDCDEIQFMEDGSWCPMKPKKEASEVCPP
PGYGLDGLQYSPVQGGDPSENKKKVEVIDLTIESSSDEEDLPPTKKHCSVTSAAIPALPG
SKGVLTSGHQPSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQ
HYGPSVITSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSIVAPG
GALREGHGGPLPSGPSLTGCRSDIISLD

Sequence length

628

Interactions

View interactions

	KEGG		Reactome
	Ubiquitin mediated proteolysis JAK-STAT signaling pathway		SUMOylation of transcription factors SUMOylation of transcription cofactors SUMOylation of intracellular receptors SUMOylation of DNA replication proteins SUMOylation of immune response proteins Formation of Incision Complex in GG-NER

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
UTERINE CERVICAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (69)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	25713074		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	30537729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	21497567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	28035977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	LHGDN	14630083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	34837964	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	34030529	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	15138572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	LHGDN	15138572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19760037, 28423498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18246042	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20854925, 22174013, 26768588, 28423498	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	19759907	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36748193	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	19569236, 21497567, 23959540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	23959540, 25573684	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28972958	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	CTD_human_DG	25061499		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	26432044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	26432044, 30937952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	28035977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic colitis	Colitis	BEFREE	29896300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28947822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	16098628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24621823, 29896300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24621823, 29123263, 32964969, 33155205	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	21317457	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28100038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21317457, 28100038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	21317457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	21317457	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	14630083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	16098628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	LHGDN	16098628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	33155205	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	17032498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	17032498, 23959540	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21497567	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	25124686, 30259640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19760037, 28423498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	19569236, 21497567, 23959540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15138572, 20854925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	21925039, 23322197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15138572, 25124686, 29339537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	26432044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	28035977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	28035977	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	25124686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	30259640	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	23959540	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11429412, 22316494	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	30316680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25124686, 25137041, 25573684, 28120918, 29896300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	19569236, 21497567, 25137041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	22969086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	22174013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28120918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	30537729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15138572, 20854925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20854925, 32415173	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	25573684	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	21497567, 23959540, 26432044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	25573684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	21925039, 23322197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	23322197	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23322197	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	24301930	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	24301930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	CTD_human_DG	25061499		★★★★★ ★☆☆☆☆ Found in Text Mining only

PIAS3 (protein inhibitor of activated STAT 3)