Gene Gene information from NCBI Gene database.
Entrez ID 10398
Gene name Myosin light chain 9
Gene symbol MYL9
Synonyms (NCBI Gene)
LC20MLC-2CMLC2MMIHS4MRLC1MYRL2
Chromosome 20
Chromosome location 20q11.23
Summary Myosin, a structural component of muscle, consists of two heavy chains and four light chains. The protein encoded by this gene is a myosin light chain that may regulate muscle contraction by modulating the ATPase activity of myosin heads. The encoded prot
miRNA miRNA information provided by mirtarbase database.
108
miRTarBase ID miRNA Experiments Reference
MIRT437478 hsa-miR-663a Luciferase reporter assayqRT-PCRWestern blot 24014830
MIRT490441 hsa-miR-3936 PAR-CLIP 23592263
MIRT490442 hsa-miR-6782-5p PAR-CLIP 23592263
MIRT490440 hsa-miR-6840-3p PAR-CLIP 23592263
MIRT490439 hsa-miR-1915-3p PAR-CLIP 23592263
Transcription factors Transcription factors information provided by TRRUST V2 database.
3
Transcription factor Regulation Reference
MAL Unknown 19724058
RUNX1 Unknown 20876458;22898599
SRF Unknown 19724058
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
26
GO ID Ontology Definition Evidence Reference
GO:0001725 Component Stress fiber IBA
GO:0001725 Component Stress fiber IDA 39106863
GO:0001725 Component Stress fiber IEA
GO:0005200 Function Structural constituent of cytoskeleton IDA 39106863
GO:0005509 Function Calcium ion binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609905 15754 ENSG00000101335
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P24844
Protein name Myosin regulatory light polypeptide 9 (20 kDa myosin light chain) (LC20) (MLC-2C) (Myosin RLC) (Myosin regulatory light chain 2, smooth muscle isoform) (Myosin regulatory light chain 9) (Myosin regulatory light chain MRLC1)
Protein function Myosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Implicated in cytokinesis, receptor capping, and cell locomotion (PubMed:11942626, PubMed
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13405 EF-hand_6 33 62 EF-hand domain Domain
PF13833 EF-hand_8 114 166 EF-hand domain pair Domain
Tissue specificity TISSUE SPECIFICITY: Smooth muscle tissues and in some, but not all, nonmuscle cells. {ECO:0000269|PubMed:2526655}.
Sequence
MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LG
KNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHE
DHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHG
AKDKDD
Sequence length 172
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  cGMP-PKG signaling pathway
cAMP signaling pathway
Vascular smooth muscle contraction
Axon guidance
Focal adhesion
Adherens junction
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Motor proteins
Cytoskeleton in muscle cells
Oxytocin signaling pathway
Shigellosis
Salmonella infection
  Smooth Muscle Contraction
RHO GTPases activate PAKs
RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
7
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
BRAIN EDEMA CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, HYPERTROPHIC, FAMILIAL Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
MEGACYSTIS MICROCOLON INTESTINAL HYPOPERISTALSIS SYNDROME Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adrenocortical Carcinoma Adrenocortical carcinoma Pubtator 34729929 Associate
★☆☆☆☆
Found in Text Mining only
Aortic Aneurysm Abdominal Aortic aneurysm Pubtator 34852854 Associate
★☆☆☆☆
Found in Text Mining only
Apraxia, Developmental Verbal Apraxia BEFREE 29378169
★☆☆☆☆
Found in Text Mining only
Blood Platelet Disorders Platelet disorder Pubtator 20876458 Associate
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 34729929, 34911847 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 34729929 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma of lung Lung carcinoma BEFREE 25179839
★☆☆☆☆
Found in Text Mining only
Carcinoma Pancreatic Ductal Pancreatic ductal carcinoma Pubtator 34821071 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Squamous Cell Squamous cell carcinoma Pubtator 34729929 Inhibit
★☆☆☆☆
Found in Text Mining only
Cardiomyopathies Cardiomyopathy BEFREE 24374283
★☆☆☆☆
Found in Text Mining only