Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10395
Gene name	DLC1 Rho GTPase activating protein
Gene symbol	DLC1
Synonyms (NCBI Gene)	ARHGAP7HPSTARD12p122-RhoGAP
Chromosome	8
Chromosome location	8p22
Summary	This gene encodes a GTPase-activating protein (GAP) that is a member of the rhoGAP family of proteins which play a role in the regulation of small GTP-binding proteins. GAP family proteins participate in signaling pathways that regulate cell processes inv

Show/Hide all (3)

SNP ID	Visualize variation	Clinical significance	Consequence
rs121908500	T>C	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant
rs1303000329	G>A,T	Risk-factor	Missense variant, intron variant, 5 prime UTR variant, genic downstream transcript variant, coding sequence variant
rs1563593163	G>A	Risk-factor	Stop gained, coding sequence variant, genic downstream transcript variant

665

Show/Hide all (665)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005042	hsa-let-7b-5p	Microarray	17699775
MIRT021186	hsa-miR-186-5p	Sequencing	20371350
MIRT031720	hsa-miR-16-5p	Sequencing	20371350
MIRT032148	hsa-let-7d-5p	Sequencing	20371350
MIRT050541	hsa-miR-20a-5p	CLASH	23622248
MIRT048014	hsa-miR-30c-5p	CLASH	23622248
MIRT036947	hsa-miR-877-3p	CLASH	23622248
MIRT054545	hsa-miR-200a-3p	Western blotqRT-PCR	23708087
MIRT054545	hsa-miR-200a-3p	Western blotqRT-PCR	23708087
MIRT054548	hsa-miR-200b-3p	Western blotqRT-PCR	23708087
MIRT054548	hsa-miR-200b-3p	Western blotqRT-PCR	23708087
MIRT054549	hsa-miR-200c-3p	Western blotqRT-PCR	23708087
MIRT054549	hsa-miR-200c-3p	Western blotqRT-PCR	23708087
MIRT054549	hsa-miR-200c-3p	Western blotqRT-PCR	23708087
MIRT054549	hsa-miR-200c-3p	Western blotqRT-PCR	23708087
MIRT054549	hsa-miR-200c-3p	Western blotqRT-PCR	23708087
MIRT054549	hsa-miR-200c-3p	Western blotqRT-PCR	23708087
MIRT711441	hsa-miR-4778-3p	HITS-CLIP	19536157
MIRT711440	hsa-miR-5087	HITS-CLIP	19536157
MIRT711439	hsa-miR-6740-5p	HITS-CLIP	19536157
MIRT711438	hsa-miR-3940-5p	HITS-CLIP	19536157
MIRT711437	hsa-miR-4507	HITS-CLIP	19536157
MIRT711436	hsa-miR-6839-3p	HITS-CLIP	19536157
MIRT711435	hsa-miR-29b-2-5p	HITS-CLIP	19536157
MIRT711434	hsa-miR-744-3p	HITS-CLIP	19536157
MIRT711433	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT711432	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT711431	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT711430	hsa-miR-578	HITS-CLIP	19536157
MIRT711441	hsa-miR-4778-3p	HITS-CLIP	19536157
MIRT711440	hsa-miR-5087	HITS-CLIP	19536157
MIRT711439	hsa-miR-6740-5p	HITS-CLIP	19536157
MIRT711438	hsa-miR-3940-5p	HITS-CLIP	19536157
MIRT711437	hsa-miR-4507	HITS-CLIP	19536157
MIRT711436	hsa-miR-6839-3p	HITS-CLIP	19536157
MIRT711435	hsa-miR-29b-2-5p	HITS-CLIP	19536157
MIRT711434	hsa-miR-744-3p	HITS-CLIP	19536157
MIRT711433	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT711432	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT711431	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT711430	hsa-miR-578	HITS-CLIP	19536157
MIRT711441	hsa-miR-4778-3p	HITS-CLIP	19536157
MIRT711440	hsa-miR-5087	HITS-CLIP	19536157
MIRT711439	hsa-miR-6740-5p	HITS-CLIP	19536157
MIRT711438	hsa-miR-3940-5p	HITS-CLIP	19536157
MIRT711437	hsa-miR-4507	HITS-CLIP	19536157
MIRT711436	hsa-miR-6839-3p	HITS-CLIP	19536157
MIRT711435	hsa-miR-29b-2-5p	HITS-CLIP	19536157
MIRT711434	hsa-miR-744-3p	HITS-CLIP	19536157
MIRT711433	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT711432	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT711431	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT711430	hsa-miR-578	HITS-CLIP	19536157
MIRT711441	hsa-miR-4778-3p	HITS-CLIP	19536157
MIRT711440	hsa-miR-5087	HITS-CLIP	19536157
MIRT711439	hsa-miR-6740-5p	HITS-CLIP	19536157
MIRT711438	hsa-miR-3940-5p	HITS-CLIP	19536157
MIRT711437	hsa-miR-4507	HITS-CLIP	19536157
MIRT711436	hsa-miR-6839-3p	HITS-CLIP	19536157
MIRT711435	hsa-miR-29b-2-5p	HITS-CLIP	19536157
MIRT711434	hsa-miR-744-3p	HITS-CLIP	19536157
MIRT711433	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT711432	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT711431	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT711430	hsa-miR-578	HITS-CLIP	19536157
MIRT504717	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT504716	hsa-miR-495-3p	PAR-CLIP	20371350
MIRT504714	hsa-miR-5688	PAR-CLIP	20371350
MIRT504715	hsa-miR-646	PAR-CLIP	20371350
MIRT504713	hsa-miR-6828-5p	PAR-CLIP	20371350
MIRT573402	hsa-miR-6753-5p	PAR-CLIP	20371350
MIRT573401	hsa-miR-1226-3p	PAR-CLIP	20371350
MIRT573400	hsa-miR-4733-3p	PAR-CLIP	20371350
MIRT573399	hsa-miR-6823-5p	PAR-CLIP	20371350
MIRT573398	hsa-miR-3140-5p	PAR-CLIP	20371350
MIRT573397	hsa-miR-1266-3p	PAR-CLIP	20371350
MIRT573396	hsa-miR-412-3p	PAR-CLIP	20371350
MIRT573394	hsa-miR-6754-3p	PAR-CLIP	20371350
MIRT573395	hsa-miR-197-3p	PAR-CLIP	20371350
MIRT573393	hsa-miR-3074-5p	PAR-CLIP	20371350
MIRT573392	hsa-miR-7152-5p	PAR-CLIP	20371350
MIRT504717	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT504715	hsa-miR-646	PAR-CLIP	20371350
MIRT504713	hsa-miR-6828-5p	PAR-CLIP	20371350
MIRT504717	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT504716	hsa-miR-495-3p	PAR-CLIP	20371350
MIRT504714	hsa-miR-5688	PAR-CLIP	20371350
MIRT504715	hsa-miR-646	PAR-CLIP	20371350
MIRT504713	hsa-miR-6828-5p	PAR-CLIP	20371350
MIRT567772	hsa-miR-4295	PAR-CLIP	20371350
MIRT567771	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT567770	hsa-miR-3666	PAR-CLIP	20371350
MIRT567769	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT567768	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT567767	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT567766	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT105135	hsa-miR-5683	PAR-CLIP	20371350
MIRT567765	hsa-miR-2278	PAR-CLIP	20371350
MIRT567764	hsa-miR-3976	PAR-CLIP	20371350
MIRT567763	hsa-miR-633	PAR-CLIP	20371350
MIRT567762	hsa-miR-4671-3p	PAR-CLIP	20371350
MIRT567761	hsa-miR-374a-5p	PAR-CLIP	20371350
MIRT567760	hsa-miR-374b-5p	PAR-CLIP	20371350
MIRT567759	hsa-miR-4325	PAR-CLIP	20371350
MIRT105128	hsa-let-7a-2-3p	PAR-CLIP	20371350
MIRT105129	hsa-let-7g-3p	PAR-CLIP	20371350
MIRT567758	hsa-miR-576-3p	PAR-CLIP	20371350
MIRT567757	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT567756	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT567755	hsa-miR-511-3p	PAR-CLIP	20371350
MIRT567754	hsa-miR-1205	PAR-CLIP	20371350
MIRT567753	hsa-miR-6132	PAR-CLIP	20371350
MIRT567752	hsa-miR-6836-5p	PAR-CLIP	20371350
MIRT567751	hsa-miR-1909-3p	PAR-CLIP	20371350
MIRT567750	hsa-miR-6722-3p	PAR-CLIP	20371350
MIRT567749	hsa-miR-4450	PAR-CLIP	20371350
MIRT567748	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT504717	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT504715	hsa-miR-646	PAR-CLIP	20371350
MIRT504713	hsa-miR-6828-5p	PAR-CLIP	20371350
MIRT504716	hsa-miR-495-3p	PAR-CLIP	21572407
MIRT504714	hsa-miR-5688	PAR-CLIP	21572407
MIRT504715	hsa-miR-646	PAR-CLIP	21572407
MIRT504713	hsa-miR-6828-5p	PAR-CLIP	21572407
MIRT504717	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT504716	hsa-miR-495-3p	PAR-CLIP	21572407
MIRT504714	hsa-miR-5688	PAR-CLIP	21572407
MIRT504715	hsa-miR-646	PAR-CLIP	21572407
MIRT504713	hsa-miR-6828-5p	PAR-CLIP	21572407
MIRT538067	hsa-miR-3617-5p	PAR-CLIP	22012620
MIRT538066	hsa-miR-641	PAR-CLIP	22012620
MIRT538065	hsa-miR-5680	PAR-CLIP	22012620
MIRT538064	hsa-miR-4496	PAR-CLIP	22012620
MIRT538063	hsa-miR-3163	PAR-CLIP	22012620
MIRT538062	hsa-miR-203a-3p	PAR-CLIP	22012620
MIRT450397	hsa-miR-3148	PAR-CLIP	22012620
MIRT450396	hsa-miR-4668-5p	PAR-CLIP	22012620
MIRT538061	hsa-miR-8065	PAR-CLIP	22012620
MIRT504717	hsa-miR-548c-3p	PAR-CLIP	23446348
MIRT504716	hsa-miR-495-3p	PAR-CLIP	23446348
MIRT504714	hsa-miR-5688	PAR-CLIP	23446348
MIRT504715	hsa-miR-646	PAR-CLIP	23446348
MIRT504713	hsa-miR-6828-5p	PAR-CLIP	23446348
MIRT450399	hsa-miR-548az-5p	PAR-CLIP	22100165
MIRT450398	hsa-miR-548t-5p	PAR-CLIP	22100165
MIRT450397	hsa-miR-3148	PAR-CLIP	22100165
MIRT450396	hsa-miR-4668-5p	PAR-CLIP	22100165
MIRT450395	hsa-miR-1273e	PAR-CLIP	22100165
MIRT054549	hsa-miR-200c-3p	qRT-PCR	26260454
MIRT054549	hsa-miR-200c-3p	qRT-PCR	26260454
MIRT054549	hsa-miR-200c-3p	Luciferase reporter assayqRT-PCRWestern blotting	34071861
MIRT054549	hsa-miR-200c-3p	Luciferase reporter assayqRT-PCRWestern blotting	34071861
MIRT733141	hsa-miR-106b-3p	Immunohistochemistry (IHC)Luciferase reporter assayRNA-seqqRT-PCRWestern blotting	32065214
MIRT737089	hsa-miR-873-5p	Luciferase reporter assayWestern blottingqRT-PCR	33439397
MIRT711441	hsa-miR-4778-3p	HITS-CLIP	19536157
MIRT711440	hsa-miR-5087	HITS-CLIP	19536157
MIRT711439	hsa-miR-6740-5p	HITS-CLIP	19536157
MIRT711438	hsa-miR-3940-5p	HITS-CLIP	19536157
MIRT711437	hsa-miR-4507	HITS-CLIP	19536157
MIRT711436	hsa-miR-6839-3p	HITS-CLIP	19536157
MIRT711435	hsa-miR-29b-2-5p	HITS-CLIP	19536157
MIRT711434	hsa-miR-744-3p	HITS-CLIP	19536157
MIRT711433	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT711432	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT711431	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT711430	hsa-miR-578	HITS-CLIP	19536157
MIRT711441	hsa-miR-4778-3p	HITS-CLIP	19536157
MIRT711440	hsa-miR-5087	HITS-CLIP	19536157
MIRT711439	hsa-miR-6740-5p	HITS-CLIP	19536157
MIRT711438	hsa-miR-3940-5p	HITS-CLIP	19536157
MIRT711437	hsa-miR-4507	HITS-CLIP	19536157
MIRT711436	hsa-miR-6839-3p	HITS-CLIP	19536157
MIRT711435	hsa-miR-29b-2-5p	HITS-CLIP	19536157
MIRT711434	hsa-miR-744-3p	HITS-CLIP	19536157
MIRT711433	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT711432	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT711431	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT711430	hsa-miR-578	HITS-CLIP	19536157
MIRT711441	hsa-miR-4778-3p	HITS-CLIP	19536157
MIRT711440	hsa-miR-5087	HITS-CLIP	19536157
MIRT711439	hsa-miR-6740-5p	HITS-CLIP	19536157
MIRT711438	hsa-miR-3940-5p	HITS-CLIP	19536157
MIRT711437	hsa-miR-4507	HITS-CLIP	19536157
MIRT711436	hsa-miR-6839-3p	HITS-CLIP	19536157
MIRT711435	hsa-miR-29b-2-5p	HITS-CLIP	19536157
MIRT711434	hsa-miR-744-3p	HITS-CLIP	19536157
MIRT711433	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT711432	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT711431	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT711430	hsa-miR-578	HITS-CLIP	19536157
MIRT504717	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT504716	hsa-miR-495-3p	PAR-CLIP	20371350
MIRT504714	hsa-miR-5688	PAR-CLIP	20371350
MIRT504715	hsa-miR-646	PAR-CLIP	20371350
MIRT504713	hsa-miR-6828-5p	PAR-CLIP	20371350
MIRT573402	hsa-miR-6753-5p	PAR-CLIP	20371350
MIRT573401	hsa-miR-1226-3p	PAR-CLIP	20371350
MIRT573400	hsa-miR-4733-3p	PAR-CLIP	20371350
MIRT573399	hsa-miR-6823-5p	PAR-CLIP	20371350
MIRT573398	hsa-miR-3140-5p	PAR-CLIP	20371350
MIRT573397	hsa-miR-1266-3p	PAR-CLIP	20371350
MIRT573396	hsa-miR-412-3p	PAR-CLIP	20371350
MIRT573394	hsa-miR-6754-3p	PAR-CLIP	20371350
MIRT573395	hsa-miR-197-3p	PAR-CLIP	20371350
MIRT573393	hsa-miR-3074-5p	PAR-CLIP	20371350
MIRT573392	hsa-miR-7152-5p	PAR-CLIP	20371350
MIRT504717	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT504715	hsa-miR-646	PAR-CLIP	20371350
MIRT504713	hsa-miR-6828-5p	PAR-CLIP	20371350
MIRT504717	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT504716	hsa-miR-495-3p	PAR-CLIP	20371350
MIRT504714	hsa-miR-5688	PAR-CLIP	20371350
MIRT504715	hsa-miR-646	PAR-CLIP	20371350
MIRT504713	hsa-miR-6828-5p	PAR-CLIP	20371350
MIRT567772	hsa-miR-4295	PAR-CLIP	20371350
MIRT567771	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT567770	hsa-miR-3666	PAR-CLIP	20371350
MIRT567769	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT567768	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT567767	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT567766	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT105135	hsa-miR-5683	PAR-CLIP	20371350
MIRT567765	hsa-miR-2278	PAR-CLIP	20371350
MIRT567764	hsa-miR-3976	PAR-CLIP	20371350
MIRT567763	hsa-miR-633	PAR-CLIP	20371350
MIRT567762	hsa-miR-4671-3p	PAR-CLIP	20371350
MIRT567761	hsa-miR-374a-5p	PAR-CLIP	20371350
MIRT567760	hsa-miR-374b-5p	PAR-CLIP	20371350
MIRT567759	hsa-miR-4325	PAR-CLIP	20371350
MIRT105128	hsa-let-7a-2-3p	PAR-CLIP	20371350
MIRT105129	hsa-let-7g-3p	PAR-CLIP	20371350
MIRT567758	hsa-miR-576-3p	PAR-CLIP	20371350
MIRT567757	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT567756	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT567755	hsa-miR-511-3p	PAR-CLIP	20371350
MIRT567754	hsa-miR-1205	PAR-CLIP	20371350
MIRT567753	hsa-miR-6132	PAR-CLIP	20371350
MIRT567752	hsa-miR-6836-5p	PAR-CLIP	20371350
MIRT567751	hsa-miR-1909-3p	PAR-CLIP	20371350
MIRT567750	hsa-miR-6722-3p	PAR-CLIP	20371350
MIRT567749	hsa-miR-4450	PAR-CLIP	20371350
MIRT567748	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT504717	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT504715	hsa-miR-646	PAR-CLIP	20371350
MIRT504713	hsa-miR-6828-5p	PAR-CLIP	20371350
MIRT504716	hsa-miR-495-3p	PAR-CLIP	21572407
MIRT504714	hsa-miR-5688	PAR-CLIP	21572407
MIRT504715	hsa-miR-646	PAR-CLIP	21572407
MIRT504713	hsa-miR-6828-5p	PAR-CLIP	21572407
MIRT504717	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT504716	hsa-miR-495-3p	PAR-CLIP	21572407
MIRT504714	hsa-miR-5688	PAR-CLIP	21572407
MIRT504715	hsa-miR-646	PAR-CLIP	21572407
MIRT504713	hsa-miR-6828-5p	PAR-CLIP	21572407
MIRT538067	hsa-miR-3617-5p	PAR-CLIP	22012620
MIRT538066	hsa-miR-641	PAR-CLIP	22012620
MIRT538065	hsa-miR-5680	PAR-CLIP	22012620
MIRT538064	hsa-miR-4496	PAR-CLIP	22012620
MIRT538063	hsa-miR-3163	PAR-CLIP	22012620
MIRT538062	hsa-miR-203a-3p	PAR-CLIP	22012620
MIRT450397	hsa-miR-3148	PAR-CLIP	22012620
MIRT450396	hsa-miR-4668-5p	PAR-CLIP	22012620
MIRT538061	hsa-miR-8065	PAR-CLIP	22012620
MIRT504717	hsa-miR-548c-3p	PAR-CLIP	23446348
MIRT504716	hsa-miR-495-3p	PAR-CLIP	23446348
MIRT504714	hsa-miR-5688	PAR-CLIP	23446348
MIRT504715	hsa-miR-646	PAR-CLIP	23446348
MIRT504713	hsa-miR-6828-5p	PAR-CLIP	23446348
MIRT450399	hsa-miR-548az-5p	PAR-CLIP	22100165
MIRT450398	hsa-miR-548t-5p	PAR-CLIP	22100165
MIRT450397	hsa-miR-3148	PAR-CLIP	22100165
MIRT450396	hsa-miR-4668-5p	PAR-CLIP	22100165
MIRT450395	hsa-miR-1273e	PAR-CLIP	22100165
MIRT737089	hsa-miR-873-5p	Luciferase reporter assayWestern blottingqRT-PCR	33439397
MIRT054545	hsa-miR-200a-3p	Luciferase reporter assayWestern blottingqRT-PCRImmunohistochemistry (IHC)	34751841
MIRT937794	hsa-miR-181a	CLIP-seq
MIRT937795	hsa-miR-181b	CLIP-seq
MIRT937796	hsa-miR-181c	CLIP-seq
MIRT937797	hsa-miR-181d	CLIP-seq
MIRT937798	hsa-miR-377	CLIP-seq
MIRT937799	hsa-miR-4262	CLIP-seq
MIRT937800	hsa-let-7a	CLIP-seq
MIRT937801	hsa-let-7b	CLIP-seq
MIRT937802	hsa-let-7c	CLIP-seq
MIRT937803	hsa-let-7d	CLIP-seq
MIRT937804	hsa-let-7e	CLIP-seq
MIRT937805	hsa-let-7f	CLIP-seq
MIRT937806	hsa-let-7g	CLIP-seq
MIRT937807	hsa-let-7i	CLIP-seq
MIRT937808	hsa-miR-1	CLIP-seq
MIRT937809	hsa-miR-101	CLIP-seq
MIRT937810	hsa-miR-106a	CLIP-seq
MIRT937811	hsa-miR-106b	CLIP-seq
MIRT937812	hsa-miR-1227	CLIP-seq
MIRT937813	hsa-miR-1276	CLIP-seq
MIRT937814	hsa-miR-128	CLIP-seq
MIRT937815	hsa-miR-129-5p	CLIP-seq
MIRT937816	hsa-miR-1299	CLIP-seq
MIRT937817	hsa-miR-130a	CLIP-seq
MIRT937818	hsa-miR-130b	CLIP-seq
MIRT937819	hsa-miR-141	CLIP-seq
MIRT937820	hsa-miR-144	CLIP-seq
MIRT937821	hsa-miR-145	CLIP-seq
MIRT937822	hsa-miR-151-3p	CLIP-seq
MIRT937823	hsa-miR-17	CLIP-seq
MIRT937824	hsa-miR-186	CLIP-seq
MIRT937825	hsa-miR-1909	CLIP-seq
MIRT937826	hsa-miR-200a	CLIP-seq
MIRT937827	hsa-miR-200b	CLIP-seq
MIRT937828	hsa-miR-200c	CLIP-seq
MIRT937829	hsa-miR-202	CLIP-seq
MIRT937830	hsa-miR-203	CLIP-seq
MIRT937831	hsa-miR-205	CLIP-seq
MIRT937832	hsa-miR-206	CLIP-seq
MIRT937833	hsa-miR-20a	CLIP-seq
MIRT937834	hsa-miR-20b	CLIP-seq
MIRT937835	hsa-miR-219-5p	CLIP-seq
MIRT937836	hsa-miR-2681	CLIP-seq
MIRT937837	hsa-miR-300	CLIP-seq
MIRT937838	hsa-miR-301a	CLIP-seq
MIRT937839	hsa-miR-301b	CLIP-seq
MIRT937840	hsa-miR-3065-5p	CLIP-seq
MIRT937841	hsa-miR-3129-3p	CLIP-seq
MIRT937842	hsa-miR-3133	CLIP-seq
MIRT937843	hsa-miR-3138	CLIP-seq
MIRT937844	hsa-miR-3153	CLIP-seq
MIRT937845	hsa-miR-3157-5p	CLIP-seq
MIRT937846	hsa-miR-3173-5p	CLIP-seq
MIRT937847	hsa-miR-3200-5p	CLIP-seq
MIRT937848	hsa-miR-340	CLIP-seq
MIRT937849	hsa-miR-3609	CLIP-seq
MIRT937850	hsa-miR-3647-3p	CLIP-seq
MIRT937851	hsa-miR-3658	CLIP-seq
MIRT937852	hsa-miR-3673	CLIP-seq
MIRT937853	hsa-miR-3676	CLIP-seq
MIRT937854	hsa-miR-374a	CLIP-seq
MIRT937855	hsa-miR-374b	CLIP-seq
MIRT937856	hsa-miR-381	CLIP-seq
MIRT937857	hsa-miR-3915	CLIP-seq
MIRT937858	hsa-miR-3928	CLIP-seq
MIRT937859	hsa-miR-3973	CLIP-seq
MIRT937860	hsa-miR-412	CLIP-seq
MIRT937861	hsa-miR-4290	CLIP-seq
MIRT937862	hsa-miR-4291	CLIP-seq
MIRT937863	hsa-miR-4302	CLIP-seq
MIRT937864	hsa-miR-4307	CLIP-seq
MIRT937865	hsa-miR-4311	CLIP-seq
MIRT937866	hsa-miR-433	CLIP-seq
MIRT937867	hsa-miR-4427	CLIP-seq
MIRT937868	hsa-miR-4445	CLIP-seq
MIRT937869	hsa-miR-4455	CLIP-seq
MIRT937870	hsa-miR-4458	CLIP-seq
MIRT937871	hsa-miR-4463	CLIP-seq
MIRT937872	hsa-miR-4484	CLIP-seq
MIRT937873	hsa-miR-4499	CLIP-seq
MIRT937874	hsa-miR-4500	CLIP-seq
MIRT937875	hsa-miR-4506	CLIP-seq
MIRT937876	hsa-miR-450b-5p	CLIP-seq
MIRT937877	hsa-miR-454	CLIP-seq
MIRT937878	hsa-miR-4649-3p	CLIP-seq
MIRT937879	hsa-miR-4659a-5p	CLIP-seq
MIRT937880	hsa-miR-4659b-5p	CLIP-seq
MIRT937881	hsa-miR-4666-3p	CLIP-seq
MIRT937882	hsa-miR-4691-3p	CLIP-seq
MIRT937883	hsa-miR-4698	CLIP-seq
MIRT937884	hsa-miR-4699-3p	CLIP-seq
MIRT937885	hsa-miR-4714-3p	CLIP-seq
MIRT937886	hsa-miR-4716-5p	CLIP-seq
MIRT937887	hsa-miR-4731-3p	CLIP-seq
MIRT937888	hsa-miR-4742-3p	CLIP-seq
MIRT937889	hsa-miR-4761-5p	CLIP-seq
MIRT937890	hsa-miR-4762-5p	CLIP-seq
MIRT937891	hsa-miR-4776-3p	CLIP-seq
MIRT937892	hsa-miR-4782-3p	CLIP-seq
MIRT937893	hsa-miR-4786-3p	CLIP-seq
MIRT937894	hsa-miR-4790-3p	CLIP-seq
MIRT937895	hsa-miR-4796-3p	CLIP-seq
MIRT937896	hsa-miR-4801	CLIP-seq
MIRT937897	hsa-miR-488	CLIP-seq
MIRT937898	hsa-miR-495	CLIP-seq
MIRT937899	hsa-miR-500a	CLIP-seq
MIRT937900	hsa-miR-507	CLIP-seq
MIRT937901	hsa-miR-508-3p	CLIP-seq
MIRT937902	hsa-miR-513a-3p	CLIP-seq
MIRT937903	hsa-miR-519d	CLIP-seq
MIRT937904	hsa-miR-520d-5p	CLIP-seq
MIRT937905	hsa-miR-520g	CLIP-seq
MIRT937906	hsa-miR-520h	CLIP-seq
MIRT937907	hsa-miR-522	CLIP-seq
MIRT937908	hsa-miR-524-5p	CLIP-seq
MIRT937909	hsa-miR-526b	CLIP-seq
MIRT937910	hsa-miR-545	CLIP-seq
MIRT937911	hsa-miR-548aa	CLIP-seq
MIRT937912	hsa-miR-548ah	CLIP-seq
MIRT937913	hsa-miR-548b-3p	CLIP-seq
MIRT937914	hsa-miR-548k	CLIP-seq
MIRT937915	hsa-miR-548t	CLIP-seq
MIRT937916	hsa-miR-548u	CLIP-seq
MIRT937917	hsa-miR-557	CLIP-seq
MIRT937918	hsa-miR-582-5p	CLIP-seq
MIRT937919	hsa-miR-593	CLIP-seq
MIRT937920	hsa-miR-595	CLIP-seq
MIRT937921	hsa-miR-600	CLIP-seq
MIRT937922	hsa-miR-609	CLIP-seq
MIRT937923	hsa-miR-613	CLIP-seq
MIRT937924	hsa-miR-627	CLIP-seq
MIRT937925	hsa-miR-630	CLIP-seq
MIRT937926	hsa-miR-640	CLIP-seq
MIRT937927	hsa-miR-648	CLIP-seq
MIRT937928	hsa-miR-671-5p	CLIP-seq
MIRT937929	hsa-miR-875-3p	CLIP-seq
MIRT937930	hsa-miR-885-5p	CLIP-seq
MIRT937931	hsa-miR-93	CLIP-seq
MIRT937932	hsa-miR-98	CLIP-seq
MIRT937810	hsa-miR-106a	CLIP-seq
MIRT937811	hsa-miR-106b	CLIP-seq
MIRT937822	hsa-miR-151-3p	CLIP-seq
MIRT937823	hsa-miR-17	CLIP-seq
MIRT937833	hsa-miR-20a	CLIP-seq
MIRT937834	hsa-miR-20b	CLIP-seq
MIRT937849	hsa-miR-3609	CLIP-seq
MIRT937871	hsa-miR-4463	CLIP-seq
MIRT937873	hsa-miR-4499	CLIP-seq
MIRT937884	hsa-miR-4699-3p	CLIP-seq
MIRT937888	hsa-miR-4742-3p	CLIP-seq
MIRT937895	hsa-miR-4796-3p	CLIP-seq
MIRT937903	hsa-miR-519d	CLIP-seq
MIRT937912	hsa-miR-548ah	CLIP-seq
MIRT937925	hsa-miR-630	CLIP-seq
MIRT937931	hsa-miR-93	CLIP-seq
MIRT937815	hsa-miR-129-5p	CLIP-seq
MIRT937876	hsa-miR-450b-5p	CLIP-seq
MIRT937900	hsa-miR-507	CLIP-seq
MIRT937902	hsa-miR-513a-3p	CLIP-seq
MIRT937917	hsa-miR-557	CLIP-seq
MIRT937840	hsa-miR-3065-5p	CLIP-seq
MIRT937845	hsa-miR-3157-5p	CLIP-seq
MIRT937882	hsa-miR-4691-3p	CLIP-seq
MIRT1977583	hsa-miR-4789-3p	CLIP-seq
MIRT937898	hsa-miR-495	CLIP-seq
MIRT937827	hsa-miR-200b	CLIP-seq
MIRT937828	hsa-miR-200c	CLIP-seq
MIRT937841	hsa-miR-3129-3p	CLIP-seq
MIRT1977584	hsa-miR-382	CLIP-seq
MIRT937876	hsa-miR-450b-5p	CLIP-seq
MIRT937899	hsa-miR-500a	CLIP-seq
MIRT937902	hsa-miR-513a-3p	CLIP-seq
MIRT937808	hsa-miR-1	CLIP-seq
MIRT937810	hsa-miR-106a	CLIP-seq
MIRT937811	hsa-miR-106b	CLIP-seq
MIRT937819	hsa-miR-141	CLIP-seq
MIRT937822	hsa-miR-151-3p	CLIP-seq
MIRT937823	hsa-miR-17	CLIP-seq
MIRT937794	hsa-miR-181a	CLIP-seq
MIRT937795	hsa-miR-181b	CLIP-seq
MIRT937796	hsa-miR-181c	CLIP-seq
MIRT937797	hsa-miR-181d	CLIP-seq
MIRT2212857	hsa-miR-19a	CLIP-seq
MIRT2212858	hsa-miR-19b	CLIP-seq
MIRT937826	hsa-miR-200a	CLIP-seq
MIRT937830	hsa-miR-203	CLIP-seq
MIRT937832	hsa-miR-206	CLIP-seq
MIRT937833	hsa-miR-20a	CLIP-seq
MIRT937834	hsa-miR-20b	CLIP-seq
MIRT937840	hsa-miR-3065-5p	CLIP-seq
MIRT937842	hsa-miR-3133	CLIP-seq
MIRT937845	hsa-miR-3157-5p	CLIP-seq
MIRT937849	hsa-miR-3609	CLIP-seq
MIRT937850	hsa-miR-3647-3p	CLIP-seq
MIRT937852	hsa-miR-3673	CLIP-seq
MIRT2212859	hsa-miR-3685	CLIP-seq
MIRT937798	hsa-miR-377	CLIP-seq
MIRT937799	hsa-miR-4262	CLIP-seq
MIRT937871	hsa-miR-4463	CLIP-seq
MIRT937873	hsa-miR-4499	CLIP-seq
MIRT937876	hsa-miR-450b-5p	CLIP-seq
MIRT937882	hsa-miR-4691-3p	CLIP-seq
MIRT937884	hsa-miR-4699-3p	CLIP-seq
MIRT937888	hsa-miR-4742-3p	CLIP-seq
MIRT937895	hsa-miR-4796-3p	CLIP-seq
MIRT937898	hsa-miR-495	CLIP-seq
MIRT937903	hsa-miR-519d	CLIP-seq
MIRT937907	hsa-miR-522	CLIP-seq
MIRT937912	hsa-miR-548ah	CLIP-seq
MIRT937913	hsa-miR-548b-3p	CLIP-seq
MIRT937915	hsa-miR-548t	CLIP-seq
MIRT937923	hsa-miR-613	CLIP-seq
MIRT937925	hsa-miR-630	CLIP-seq
MIRT937931	hsa-miR-93	CLIP-seq
MIRT937814	hsa-miR-128	CLIP-seq
MIRT2428254	hsa-miR-204	CLIP-seq
MIRT2428255	hsa-miR-211	CLIP-seq
MIRT937837	hsa-miR-300	CLIP-seq
MIRT937840	hsa-miR-3065-5p	CLIP-seq
MIRT937843	hsa-miR-3138	CLIP-seq
MIRT937846	hsa-miR-3173-5p	CLIP-seq
MIRT937856	hsa-miR-381	CLIP-seq
MIRT937864	hsa-miR-4307	CLIP-seq
MIRT2428256	hsa-miR-4446-5p	CLIP-seq
MIRT937881	hsa-miR-4666-3p	CLIP-seq
MIRT2428257	hsa-miR-4755-5p	CLIP-seq
MIRT937894	hsa-miR-4790-3p	CLIP-seq
MIRT937897	hsa-miR-488	CLIP-seq
MIRT937898	hsa-miR-495	CLIP-seq
MIRT2428258	hsa-miR-499a-5p	CLIP-seq
MIRT2428259	hsa-miR-548a-3p	CLIP-seq
MIRT2428260	hsa-miR-548e	CLIP-seq
MIRT2428261	hsa-miR-548f	CLIP-seq
MIRT2428262	hsa-miR-590-3p	CLIP-seq
MIRT2428263	hsa-miR-618	CLIP-seq
MIRT2428264	hsa-miR-623	CLIP-seq
MIRT2428265	hsa-miR-888	CLIP-seq
MIRT937800	hsa-let-7a	CLIP-seq
MIRT937801	hsa-let-7b	CLIP-seq
MIRT937802	hsa-let-7c	CLIP-seq
MIRT937803	hsa-let-7d	CLIP-seq
MIRT937804	hsa-let-7e	CLIP-seq
MIRT937805	hsa-let-7f	CLIP-seq
MIRT937806	hsa-let-7g	CLIP-seq
MIRT937807	hsa-let-7i	CLIP-seq
MIRT937810	hsa-miR-106a	CLIP-seq
MIRT937811	hsa-miR-106b	CLIP-seq
MIRT2516734	hsa-miR-1200	CLIP-seq
MIRT2516735	hsa-miR-1237	CLIP-seq
MIRT2516736	hsa-miR-1248	CLIP-seq
MIRT2516737	hsa-miR-1270	CLIP-seq
MIRT2516738	hsa-miR-146b-3p	CLIP-seq
MIRT937822	hsa-miR-151-3p	CLIP-seq
MIRT937823	hsa-miR-17	CLIP-seq
MIRT2516739	hsa-miR-185	CLIP-seq
MIRT937824	hsa-miR-186	CLIP-seq
MIRT2516740	hsa-miR-1913	CLIP-seq
MIRT2516741	hsa-miR-1973	CLIP-seq
MIRT937829	hsa-miR-202	CLIP-seq
MIRT937833	hsa-miR-20a	CLIP-seq
MIRT937834	hsa-miR-20b	CLIP-seq
MIRT2516742	hsa-miR-2115	CLIP-seq
MIRT937837	hsa-miR-300	CLIP-seq
MIRT937840	hsa-miR-3065-5p	CLIP-seq
MIRT2516743	hsa-miR-3123	CLIP-seq
MIRT937841	hsa-miR-3129-3p	CLIP-seq
MIRT937842	hsa-miR-3133	CLIP-seq
MIRT937845	hsa-miR-3157-5p	CLIP-seq
MIRT2516744	hsa-miR-3165	CLIP-seq
MIRT2516745	hsa-miR-3168	CLIP-seq
MIRT937846	hsa-miR-3173-5p	CLIP-seq
MIRT2516746	hsa-miR-3183	CLIP-seq
MIRT2516747	hsa-miR-3189-5p	CLIP-seq
MIRT2516748	hsa-miR-3190	CLIP-seq
MIRT937847	hsa-miR-3200-5p	CLIP-seq
MIRT2516749	hsa-miR-323-3p	CLIP-seq
MIRT2516750	hsa-miR-323-5p	CLIP-seq
MIRT2516751	hsa-miR-324-3p	CLIP-seq
MIRT2516752	hsa-miR-338-5p	CLIP-seq
MIRT2516753	hsa-miR-3591-3p	CLIP-seq
MIRT2516754	hsa-miR-3605-3p	CLIP-seq
MIRT937849	hsa-miR-3609	CLIP-seq
MIRT937850	hsa-miR-3647-3p	CLIP-seq
MIRT2516755	hsa-miR-3653	CLIP-seq
MIRT2516756	hsa-miR-3654	CLIP-seq
MIRT2212859	hsa-miR-3685	CLIP-seq
MIRT937856	hsa-miR-381	CLIP-seq
MIRT2516757	hsa-miR-384	CLIP-seq
MIRT2516758	hsa-miR-3977	CLIP-seq
MIRT2516759	hsa-miR-4306	CLIP-seq
MIRT2516760	hsa-miR-4327	CLIP-seq
MIRT937870	hsa-miR-4458	CLIP-seq
MIRT937871	hsa-miR-4463	CLIP-seq
MIRT2516761	hsa-miR-4470	CLIP-seq
MIRT937873	hsa-miR-4499	CLIP-seq
MIRT937874	hsa-miR-4500	CLIP-seq
MIRT2516762	hsa-miR-4502	CLIP-seq
MIRT2516763	hsa-miR-4522	CLIP-seq
MIRT2516764	hsa-miR-4531	CLIP-seq
MIRT2516765	hsa-miR-4535	CLIP-seq
MIRT2516766	hsa-miR-4644	CLIP-seq
MIRT937878	hsa-miR-4649-3p	CLIP-seq
MIRT937879	hsa-miR-4659a-5p	CLIP-seq
MIRT937880	hsa-miR-4659b-5p	CLIP-seq
MIRT2516767	hsa-miR-4668-3p	CLIP-seq
MIRT2516768	hsa-miR-4684-3p	CLIP-seq
MIRT937882	hsa-miR-4691-3p	CLIP-seq
MIRT937884	hsa-miR-4699-3p	CLIP-seq
MIRT2516769	hsa-miR-4723-3p	CLIP-seq
MIRT937888	hsa-miR-4742-3p	CLIP-seq
MIRT2516770	hsa-miR-4758-3p	CLIP-seq
MIRT937891	hsa-miR-4776-3p	CLIP-seq
MIRT2516771	hsa-miR-4777-5p	CLIP-seq
MIRT2516772	hsa-miR-4793-5p	CLIP-seq
MIRT937895	hsa-miR-4796-3p	CLIP-seq
MIRT2516773	hsa-miR-485-3p	CLIP-seq
MIRT2516774	hsa-miR-492	CLIP-seq
MIRT937898	hsa-miR-495	CLIP-seq
MIRT937899	hsa-miR-500a	CLIP-seq
MIRT2516775	hsa-miR-516a-3p	CLIP-seq
MIRT2516776	hsa-miR-518d-5p	CLIP-seq
MIRT2516777	hsa-miR-519b-5p	CLIP-seq
MIRT2516778	hsa-miR-519c-5p	CLIP-seq
MIRT937903	hsa-miR-519d	CLIP-seq
MIRT2516779	hsa-miR-520c-5p	CLIP-seq
MIRT937907	hsa-miR-522	CLIP-seq
MIRT2516780	hsa-miR-526a	CLIP-seq
MIRT2516781	hsa-miR-544	CLIP-seq
MIRT2428259	hsa-miR-548a-3p	CLIP-seq
MIRT937912	hsa-miR-548ah	CLIP-seq
MIRT937913	hsa-miR-548b-3p	CLIP-seq
MIRT2428260	hsa-miR-548e	CLIP-seq
MIRT2428261	hsa-miR-548f	CLIP-seq
MIRT2516782	hsa-miR-582-3p	CLIP-seq
MIRT2428262	hsa-miR-590-3p	CLIP-seq
MIRT937921	hsa-miR-600	CLIP-seq
MIRT2428263	hsa-miR-618	CLIP-seq
MIRT2516783	hsa-miR-620	CLIP-seq
MIRT937925	hsa-miR-630	CLIP-seq
MIRT937928	hsa-miR-671-5p	CLIP-seq
MIRT2516784	hsa-miR-874	CLIP-seq
MIRT2516785	hsa-miR-876-3p	CLIP-seq
MIRT2428265	hsa-miR-888	CLIP-seq
MIRT937931	hsa-miR-93	CLIP-seq
MIRT937932	hsa-miR-98	CLIP-seq
MIRT2516735	hsa-miR-1237	CLIP-seq
MIRT2516736	hsa-miR-1248	CLIP-seq
MIRT2516737	hsa-miR-1270	CLIP-seq
MIRT2516739	hsa-miR-185	CLIP-seq
MIRT2516743	hsa-miR-3123	CLIP-seq
MIRT937841	hsa-miR-3129-3p	CLIP-seq
MIRT2516745	hsa-miR-3168	CLIP-seq
MIRT2516746	hsa-miR-3183	CLIP-seq
MIRT2516750	hsa-miR-323-5p	CLIP-seq
MIRT2516753	hsa-miR-3591-3p	CLIP-seq
MIRT2516754	hsa-miR-3605-3p	CLIP-seq
MIRT937850	hsa-miR-3647-3p	CLIP-seq
MIRT2516756	hsa-miR-3654	CLIP-seq
MIRT2212859	hsa-miR-3685	CLIP-seq
MIRT2516757	hsa-miR-384	CLIP-seq
MIRT2516759	hsa-miR-4306	CLIP-seq
MIRT2516760	hsa-miR-4327	CLIP-seq
MIRT2516763	hsa-miR-4522	CLIP-seq
MIRT2516764	hsa-miR-4531	CLIP-seq
MIRT2516765	hsa-miR-4535	CLIP-seq
MIRT2516766	hsa-miR-4644	CLIP-seq
MIRT2516767	hsa-miR-4668-3p	CLIP-seq
MIRT2516768	hsa-miR-4684-3p	CLIP-seq
MIRT2516769	hsa-miR-4723-3p	CLIP-seq
MIRT2516771	hsa-miR-4777-5p	CLIP-seq
MIRT2516772	hsa-miR-4793-5p	CLIP-seq
MIRT2516774	hsa-miR-492	CLIP-seq
MIRT937898	hsa-miR-495	CLIP-seq
MIRT937899	hsa-miR-500a	CLIP-seq
MIRT2516776	hsa-miR-518d-5p	CLIP-seq
MIRT2516777	hsa-miR-519b-5p	CLIP-seq
MIRT2516778	hsa-miR-519c-5p	CLIP-seq
MIRT2516779	hsa-miR-520c-5p	CLIP-seq
MIRT937907	hsa-miR-522	CLIP-seq
MIRT2516780	hsa-miR-526a	CLIP-seq
MIRT2516781	hsa-miR-544	CLIP-seq
MIRT2428259	hsa-miR-548a-3p	CLIP-seq
MIRT2428260	hsa-miR-548e	CLIP-seq
MIRT2428261	hsa-miR-548f	CLIP-seq
MIRT2516782	hsa-miR-582-3p	CLIP-seq
MIRT2428262	hsa-miR-590-3p	CLIP-seq
MIRT2516783	hsa-miR-620	CLIP-seq
MIRT2516785	hsa-miR-876-3p	CLIP-seq
MIRT2428265	hsa-miR-888	CLIP-seq
MIRT937898	hsa-miR-495	CLIP-seq

Show/Hide all (41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001843	Process	Neural tube closure	ISS
GO:0003007	Process	Heart morphogenesis	ISS
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IDA	17932950
GO:0005096	Function	GTPase activator activity	IMP	17888903
GO:0005096	Function	GTPase activator activity	TAS
GO:0005515	Function	Protein binding	IPI	16951145, 17517630, 19151751, 19158340, 24412244, 32203420, 35963849
GO:0005634	Component	Nucleus	IDA	17888903
GO:0005737	Component	Cytoplasm	IDA	16951145, 17888903
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005829	Component	Cytosol	IDA	19158340
GO:0005829	Component	Cytosol	TAS
GO:0005901	Component	Caveola	IDA	16951145
GO:0005925	Component	Focal adhesion	IBA
GO:0005925	Component	Focal adhesion	IDA	16951145, 17190795
GO:0005925	Component	Focal adhesion	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	12545165, 17932950
GO:0008289	Function	Lipid binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0021575	Process	Hindbrain morphogenesis	ISS
GO:0030036	Process	Actin cytoskeleton organization	IBA
GO:0030036	Process	Actin cytoskeleton organization	ISS
GO:0030336	Process	Negative regulation of cell migration	IDA	17932950, 19158340
GO:0030336	Process	Negative regulation of cell migration	IEA
GO:0030336	Process	Negative regulation of cell migration	IMP	17888903
GO:0030864	Component	Cortical actin cytoskeleton	IDA	19158340
GO:0030900	Process	Forebrain development	ISS
GO:0032587	Component	Ruffle membrane	IDA	19158340
GO:0035023	Process	Regulation of Rho protein signal transduction	IBA
GO:0035024	Process	Negative regulation of Rho protein signal transduction	IMP	16951145
GO:0035556	Process	Intracellular signal transduction	IDA	17292327
GO:0042169	Function	SH2 domain binding	IPI	17190795
GO:0045121	Component	Membrane raft	IBA
GO:0048041	Process	Focal adhesion assembly	ISS
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	TAS
GO:0051497	Process	Negative regulation of stress fiber assembly	IDA	17932950
GO:0051895	Process	Negative regulation of focal adhesion assembly	IDA	19158340
GO:0070161	Component	Anchoring junction	IEA
GO:1900119	Process	Positive regulation of execution phase of apoptosis	IDA	17888903

MIM	HGNC	e!Ensembl
604258	2897	ENSG00000164741

Q96QB1

Protein name

Rho GTPase-activating protein 7 (Deleted in liver cancer 1 protein) (DLC-1) (HP protein) (Rho-type GTPase-activating protein 7) (START domain-containing protein 12) (StARD12) (StAR-related lipid transfer protein 12)

Protein function

Functions as a GTPase-activating protein for the small GTPases RHOA, RHOB, RHOC and CDC42, terminating their downstream signaling. This induces morphological changes and detachment through cytoskeletal reorganization, playing a critical role in

PDB

2DKY , 2GYT , 2KAP , 2LOZ , 3KUQ , 5FZT , 7TPB

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07647	SAM_2	452 → 513	SAM domain (Sterile alpha motif)	Domain
PF00620	RhoGAP	1092 → 1242	RhoGAP domain	Domain
PF01852	START	1323 → 1522	START domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highest level of expression in the spleen, with rather lower levels in prostate, testis, ovary, small intestine and colon, but none in the thymus.

Sequence

MSVAIRKRSWEEHVTHWMGQPFNSDDRNTACHHGLVADSLQASMEKDATLNVDRKEKCVS
LPDCCHGSELRDFPGRPMGHLSKDVDENDSHEGEDQFLSLEASTETLVHVSDEDNNADLC
LTDDKQVLNTQGQKTSGQHMIQGAGSLEKALPIIQSNQVSSNSWGIAGETELALVKESGE
RKVTDSISKSLELCNEISLSEIKDAPKVNAVDTLNVKDIAPEKQLLNSAVIAQQRRKPDP
PKDENERSTCNVVQNEFLDTPCTNRGLPLLKTDFGSCLLQPPSCPNGMSAENGLEKSGFS
QHQNKSPPKVKAEDGMQCLQLKETLATQEPTDNQVRLRKRKEIREDRDRARLDSMVLLIM
KLDQLDQDIENALSTSSSPSGTPTNLRRHVPDLESGSESGADTISVNQTRVNLSSDTEST
DLPSSTPVANSGTKPKTTAIQGISEKEKAEIEAKEACDWLRATGFPQYAQLYEDFLFPID
ISLVKREHDFLDRDAIEALCRRLNTLNKCAVMKLEISPHRKRSDDSDEDEPCAISGKWTF
QRDSKRWSRLEEFDVFSPKQDLVPGSPDDSHPKDGPSPGGTLMDLSERQEVSSVRSLSST
GSLPSHAPPSEDAATPRTNSVISVCSSSNLAGNDDSFGSLPSPKELSSFSFSMKGHEKTA
KSKTRSLLKRMESLKLKSSHHSKHKAPSKLGLIISGPILQEGMDEEKLKQLNCVEISALN
GNRINVPMVRKRSVSNSTQTSSSSSQSETSSAVSTPSPVTRTRSLSACNKRVGMYLEGFD
PFNQSTFNNVVEQNFKNRESYPEDTVFYIPEDHKPGTFPKALTNGSFSPSGNNGSVNWRT
GSFHGPGHISLRRENSSDSPKELKRRNSSSSMSSRLSIYDNVPGSILYSSSGDLADLENE
DIFPELDDILYHVKGMQRIVNQWSEKFSDEGDSDSALDSVSPCPSSPKQIHLDVDNDRTT
PSDLDSTGNSLNEPEEPSEIPERRDSGVGASLTRSNRHRLRWHSFQSSHRPSLNSVSLQI
NCQSVAQMNLLQKYSLLKLTALLEKYTPSNKHGFSWAVPKFMKRIKVPDYKDRSVFGVPL
TVNVQRTGQPLPQSIQQAMRYLRNHCLDQVGLFRKSGVKSRIQALRQMNEGAIDCVNYEG
QSAYDVADMLKQYFRDLPEPLMTNKLSETFLQIYQYVPKDQRLQAIKAAIMLLPDENREV
LQTLLYFLSDVTAAVKENQMTPTNLAVCLAPSLFHLNTLKRENSSPRVMQRKQSLGKPDQ
KDLNENLAATQGLAHMIAECKKLFQVPEEMSRCRNSYTEQELKPLTLEALGHLGNDDSAD
YQHFLQDCVDGLFKEVKEKFKGWVSYSTSEQAELSYKKVSEGPPLRLWRSVIEVPAVPEE
ILKRLLKEQHLWDVDLLDSKVIEILDSQTEIYQYVQNSMAPHPARDYVVLRTWRTNLPKG
ACALLLTSVDHDRAPVVGVRVNVLLSRYLIEPCGPGKSKLTYMCRVDLRGHMPEWYTKSF
GHLCAAEVVKIRDSFSNQNTETKDTKSR

Sequence length

1528

Interactions

View interactions

	Reactome
			Rho GTPase cycle

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Carcinoma of colon	Pathogenic	rs121908500	RCV000006053	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (48)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign; Likely benign; Uncertain significance; Conflicting classifications of pathogenicity	ClinVar ClinVar, HPO ClinVar, HPO	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
COLORECTAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DEFECTS, MULTIPLE TYPE S	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY STENOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DLC1-related disorder	Benign; Likely benign; Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOCELLULAR CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign; Uncertain significance	ClinVar GWAS catalog	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALIGNANT EPITHELIAL TUMOR OF OVARY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neural tube defect	risk factor	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURAL TUBE DEFECTS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUTROPENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSTRUCTIVE SLEEP APNEA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECTUM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEASONAL ALLERGIC RHINITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SMALL CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (529)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
ABLEPHARON-MACROSTOMIA SYNDROME	Ablepharon macrostomia syndrome	BEFREE	29608374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acatalasia	Acatalasia	BEFREE	14556852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Activated Protein C Resistance	Activated Protein C Resistance	BEFREE	12571435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Inflammatory Demyelinating Polyneuropathy	Inflammatory Demyelinating Polyneuropathy	BEFREE	29904402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Kidney Insufficiency	Acute Kidney Insufficiency	CTD_human_DG	28885000		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	22139079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	19101688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	27174913, 29363881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Endometrioid	Endometrial Cancer	BEFREE	19801537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	23509688, 31784980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Affective Disorders, Psychotic	Affective Psychosis	PSYGENET_DG	6182580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	LHGDN	14597045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	29448841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	26155922		★★★★★ ★☆☆☆☆ Found in Text Mining only
alpha Thalassemia	Alpha thalassemia	Pubtator	24478401	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
alpha-Thalassemia	alpha Thalassemia	BEFREE	16760505, 18554871, 24478401		★★★★★ ★☆☆☆☆ Found in Text Mining only
alpha^+^ Thalassemia	alpha Thalassemia	BEFREE	16760505, 18554871, 24478401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	21298325, 29481974, 31568752, 4038761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	31604369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaphylaxis	Anaphylaxis	Pubtator	10666182, 21497293	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	16637741, 18291005, 27694537, 28780656, 29134616, 30280481, 30464689, 30510258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	CTD_human_DG	16637741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	16637741, 16637743, 18291005	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	20881411, 36006620, 37970725	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Hemolytic	Anemia	BEFREE	30324040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	CTD_human_DG	16597321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	20881411, 21651321, 27650279, 29114966, 29193101, 29544494, 29694434, 30047285, 3583301		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANHAPTOGLOBINEMIA	Anhaptoglobinemia	UNIPROT_DG	14999562		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANHAPTOGLOBINEMIA	Anhaptoglobinemia	BEFREE	20113448, 25212669		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANHAPTOGLOBINEMIA	Anhaptoglobinemia	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	17434140, 2015008, 28069576, 30171593		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26897254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	1967566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	21296538	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	1967566, 6469263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	20376581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	14734126, 17644791, 18082523, 1967566, 21507405, 22098782, 22766337, 27190085, 27353603, 28830235, 30231995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	CTD_human_DG	16597321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	28583308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	20222116, 36517828	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	23701120	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	10970816, 21169467, 2474487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	21430262	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	12005209, 14734126, 17644791, 18082523, 1967566, 21507405, 22098782, 22766337, 23177015, 27190085, 27353603, 28830235, 30231995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	12631443, 20570470, 22403646, 22766337, 27190085	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	CTD_human_DG	16597321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	30231995	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	39864423	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	30414552		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atypical Hemolytic Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	24843058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28502607, 29072974, 30414552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	28502607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	15452167	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	CTD_human_DG	16597321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	16644703, 20943062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune hemolytic anemia	Autoimmune hemolytic anemia	BEFREE	20376581, 28324773		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30651846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	CTD_human_DG	21455586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	30774440, 6843722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	6596192		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	34559910	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	31805343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow failure syndromes	Bone marrow failure syndrome	BEFREE	20376581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	31663601	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12545165, 12759748, 14967153, 15201975, 16024604, 16740735, 16862168, 16985061, 17016643, 17418982, 19482022, 21380457, 22799310, 24590291, 26130675 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	16597321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12759748, 16048908, 17418982, 22799310, 23167376, 25425654, 26167486, 30278072, 31110002, 35191482, 35322810, 36204908	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27174913	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brittle diabetes	Brittle diabetes mellitus	CTD_human_DG	16506275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	17965626	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	20882354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	12759748, 18829524, 21217778, 34727930	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16533763, 17932950, 17965626, 19101688, 25720522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	11331273, 16980951, 19161326, 19440389, 22180715, 22645138, 23389049, 23826380, 24443565, 24807840, 26448449, 26846339, 26896598, 28158312, 28358928 View all (6 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27174913	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	31805343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21217778, 22693251, 23010077, 28468949, 30405827, 3759102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	30917846	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	23681804	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35508649, 37081700	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	23625658, 26783151, 34517553	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	27174913	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	19801537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22272086, 23060558, 23988121, 28755436, 30774440, 31160686, 3397071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	11941898, 12475459, 12750308, 12938813, 15588436, 15662028, 16854468, 16918369, 17082477, 18619522, 18667016, 18760271, 19682981, 19769483, 20415560 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	12475459, 15452167, 23399657, 23718253, 26002590, 26684170, 30646354, 30685900, 31574854, 32029134, 32794371	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	12867276		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	CTD_human_DG	19769483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	20064496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	24075749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Catalase deficiency	Acatalasia	BEFREE	14556852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	2728866, 3233780, 3456204		★★★★★ ★☆☆☆☆ Found in Text Mining only
CATARACT, MARNER TYPE	Cataract	BEFREE	3233780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	18258668, 18485912, 28282855, 28883692, 30214462, 31076989, 31210949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	LHGDN	18258668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	18258668, 28282855, 33535002	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	31924654	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	26348010, 29104730, 29518787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral microangiopathy	Pubtator	36856861	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Vasospasm	Cerebral Vasospasm	BEFREE	29104730, 31454333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	24567965, 24994788, 25213335, 28487337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	18691072, 24994788, 25213335, 29518787, 30634984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	24994788, 30646354	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	19446743		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	19446743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	28667917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	18773859, 27593557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	27593557	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	19720796, 23761102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	21546768, 22573378, 27903615, 28925931, 29134616, 31401122, 31683939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Insufficiency	Renal Insufficiency	BEFREE	27903615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30405827, 30655590, 30685900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	21380457, 26448449, 30370771, 31485278, 8395462		★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	11323115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	30646354	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	23536133, 29572449	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	21708824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	34183667	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	17418982, 18288400, 23010077, 23783552, 24604602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	18288400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23509688, 26223867, 26756179, 27174913, 27366946, 28376082, 29391890, 30362160, 30864745, 31784980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20331620, 23509688, 24694993, 26223867, 27366946, 30864745, 32023884, 33787596, 35280693	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	31485278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital absence of spleen	Asplenia	BEFREE	24567965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital cataract	Congenital Cataract	BEFREE	3456204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Disorders of Glycosylation	Congenital disorder of glycosylation	Pubtator	11302201	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Disorders of Glycosylation	Congenital disorder of glycosylation	BEFREE	28457853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	24587289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Thrombotic Thrombocytopenic Purpura	Congenital Thrombotic Thrombocytopenic Purpura	BEFREE	28662310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	16123372, 19490627, 21767674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	BEFREE	29069014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	17029774, 19380190, 2917316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	10217368, 10488955, 10809897, 11427216, 15019547, 15047650, 15298155, 18691072, 20116810, 22098782, 23312704, 24535155, 24994788, 26114833, 26483103 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	10217368, 10809897, 11427216, 15019547, 15298155, 18332093, 18691072, 20368232, 22098782, 23312704, 24535155, 24994788, 25213335, 26114833, 26483103 View all (10 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	22098782, 24130793, 26114833, 27028131, 27353603, 27539884, 31529337, 32794371, 32870172, 38484336	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	25213335	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Disease	Coronary artery disease	Pubtator	23312704, 26483103, 30727751, 32029134	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	10217368, 11427216, 15019547, 15298155, 18691072, 22098782, 23312704, 24535155, 24587289, 24994788, 26114833, 26483103, 27028131, 27353603, 27423090 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary Stenosis	BEFREE	11888529, 15047650		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	BEFREE	17357835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	34183667	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	26370551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deficiency of glucose-6-phosphate dehydrogenase	Deficiency Of Glucose-6-Phosphate Dehydrogenase	BEFREE	16637741, 7277420, 7353885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	23701120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	28423466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	3972421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	25268936, 30809196, 401356, 431798, 760696, 8267107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	28627459, 31998418	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	4038761, 6745954, 8267107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Herpetiformis	Dermatitis herpetiformis	Pubtator	18258668	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	12750308, 12941730, 15019547, 15047650, 15662028, 15852445, 16123372, 16854468, 17082477, 17939622, 18599520, 1864490, 21555971, 21722898, 22427005 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	11739174, 23283045	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	12475459, 17525367, 20415560, 21722898, 22011804, 22403646, 26171400, 28068899, 28830235, 28982674, 31504048, 32341356, 33114431, 33263263, 36461077	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	12750308, 12941730, 15019547, 15047650, 15662028, 15852445, 16123372, 16854468, 17082477, 17275123, 17525367, 1778611, 17939622, 18599520, 1864490 View all (26 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	LHGDN	17525367, 18848136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	27353603	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	19720796, 22098782, 24658196, 24994788, 25213335, 26114833, 26684170, 27028131, 31529337	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	22011804, 22300541, 23283045, 23399657, 23536133, 23990521, 25628235, 26388309, 27190085, 29572449, 30646354, 31065010, 31574854, 33114431	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	16506275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	16644703, 17939622, 18332093, 19455468, 19720796, 20368232, 22098782, 23761102, 24658196, 24994788, 25213335, 26002590, 26114833, 26122942, 26684170 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Ketosis-Prone	Diabetes Mellitus	CTD_human_DG	16506275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	16506275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	16733296, 17939622, 18032779, 1864490, 18760271, 19455468, 19682981, 21555971, 22011804, 22300541, 23399657, 23990521, 25628235, 26388309, 27190085 View all (23 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Sudden-Onset	Diabetes Mellitus	CTD_human_DG	16506275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	CTD_human_DG	16506275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	16644703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	BEFREE	11739174, 11888529, 15852445, 22447230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	11739174	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	CTD_human_DG	16597321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	29572449	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	11380078, 17220636, 19455468, 24658196, 28410926, 30486327, 31545979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	17275123, 1778611, 21555971, 28758129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	131662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	16740735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyskinesias	Dyskinesia	Pubtator	22002576	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	CTD_human_DG	16597321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	22011804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	19455468, 21555971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	26030696	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	19801537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	19801537		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	21489304	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	20236630	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	11006195, 11397854, 12652078, 19801537, 20176595, 9546730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	15866595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	20176595	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy Idiopathic Generalized	Epilepsy	Pubtator	18554871	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Generalized	Epilepsy	LHGDN	15490286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Generalized	Epilepsy	BEFREE	18554871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	14629808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	23060558, 28755436, 30774440, 31160686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	16862168, 31653132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	31653132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	31653132, 35414117	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	15484320, 36157541	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	16879055, 21053180, 9242967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	21053180	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	Pubtator	18554871	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	18369381, 23376848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	19703762	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	25493023	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	18760271, 28430371, 29411270, 30586008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	31157195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	24329682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	30640940, 31031206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	32385356	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroschisis	Gastroschisis	BEFREE	28769143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Genital Neoplasms, Female	Genital Neoplasms, Female	CTD_human_DG	16597321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gilbert Disease	Gilbert syndrome	Pubtator	28389660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11323115, 20822092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	34207114	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	11323115, 20822092		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	BEFREE	20822092, 29732051, 31773232		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	19379511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	29904402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	18727923, 31478236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	31529337	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	16123372, 21767674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	29202196, 31409902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	18923442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	18923442	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	BEFREE	12005209, 12846904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	CTD_human_DG	16597321		★★★★★ ★☆☆☆☆ Found in Text Mining only
HEMOCHROMATOSIS, TYPE 1	Hemochromatosis	BEFREE	12005209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemoglobin H Disease	Hemoglobin H Disease	BEFREE	25024506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemoglobinopathies	Hemoglobinopathy	BEFREE	2093702, 27650279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemoglobinopathies	Hemoglobinopathy	Pubtator	2093702	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Hemoglobinuria paroxysmal	Pubtator	30837665	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolysis	Hemolysis	Pubtator	17304451, 19258099, 24478401, 28982674, 29365317, 35163309, 36129843, 40446305	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolysis	Hemolysis	Pubtator	30046137	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	33616244	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	22403646	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatomegaly	Hepatomegaly	Pubtator	822772	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	12759748, 18593873, 22799310	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	26401016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary fructose intolerance syndrome	Hereditary fructosuria	BEFREE	28457853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	11738096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	CTD_human_DG	16597321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary nonpolyposis colorectal carcinoma	Hereditary nonpolyposis colorectal cancer	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	16879055, 17426810, 17644791, 19259359, 19496732, 25527876, 2709394, 28991044, 30625342, 8836895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	23270508	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	15218325, 17965626, 6180585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	17965626	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	15218325, 20190739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	21297956	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	3583295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	32029134, 35163309	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	11823983, 28282855, 28314763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	28282855	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperostosis	Hyperostosis	BEFREE	28095896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	22011804	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	CTD_human_DG	16597321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	16879055, 1789936, 21053180, 22011804, 24994788, 28314763, 8228210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	16879055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	Pubtator	32575434	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy of parotid gland	Hypertrophy Of Parotid Gland	BEFREE	822772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoalphalipoproteinemias	Hypoalphalipoproteinemia	Pubtator	30510258	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	29301248	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	17609976	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis Bullosa of Siemens	Ichthyosis Bullosa Of Siemens	BEFREE	30251020, 30400824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic generalized epilepsy	Epilepsy	BEFREE	15490286, 19569003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30231995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29909421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	29909421, 32385381	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
IgA Deficiency	Selective immunoglobulin a deficiency	Pubtator	10666182	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	11166657, 31401122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	26388309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	21708824, 30160088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	19440331	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis of Pregnancy	Intrahepatic cholestasis of pregnancy	Pubtator	34559910	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intravascular hemolysis	Intravascular Hemolysis	BEFREE	12571435, 19380867, 24011966, 28684219, 30194112, 30790555, 7703038, 9884342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intravascular hemolysis	Intravascular Hemolysis	CTD_human_DG	25247420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	24567965, 29112633, 30281034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	30251020, 30400824, 31210949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	33535002	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28966798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Isolated somatotropin deficiency	Isolated Somatotropin Deficiency	BEFREE	31215990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile Neuronal Ceroid Lipofuscinosis	Neuronal Ceroid Lipofuscinosis	BEFREE	1746562, 2805379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	21748360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	17220636, 28072936, 30250850, 30486327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	31529337	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	31683939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	23761102, 26684170	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	22573378, 28072936, 28176471, 28525506, 28774273, 28946897, 28982674, 31309238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	CTD_human_DG	28885000		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	14629808, 19720796, 23761102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	12801280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lattice corneal dystrophy Type I	Lattice corneal dystrophy	BEFREE	6334443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma of uterus	Leiomyosarcoma Of Uterus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	CTD_human_DG	16597321		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	31251903, 3397067, 3460960, 6592139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	19543515, 24164743, 28407176	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	19543515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	BEFREE	27174913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11118037, 11323115, 12034501, 12531887, 12545165, 12792785, 12813468, 14633684, 14647417, 16951145, 17016643, 17292327, 17521951, 18497990, 18519636 View all (30 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12645648, 14633684, 14647417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	GWASCAT_DG	28662289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	21262313, 21380457, 26448449, 28324773, 30370771, 31485278, 8395462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	23389048, 23389049, 24807840	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	22011804, 23389048, 23389049, 23399657	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	11118037, 11323115, 12034501, 12792785, 18519636, 2172789, 2320005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	LHGDN	17292327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	23826380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	17888903, 17932950, 18257091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	20849603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	20849603, 21372205, 23639940, 24018448, 25425654, 25520076, 32441866, 33528895	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	30170966, 37111218, 40521029	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	16544281, 30170966, 3258268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	28120479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	28120479	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphadenitis	Lymphadenitis	BEFREE	29481974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23464404	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23625658, 26239822	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23681804, 23988121, 26846339	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphedema	Lymphedema	Pubtator	21497293	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	17965626, 20882354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	17965626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	17965626	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	16774933, 17965626, 19912643, 20882354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	16774933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macrocephaly	Macrocephaly	BEFREE	27979216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	28710952, 30347427, 7506108, 8267107, 9017976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	PSYGENET_DG	7506108, 8267107, 9017976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Cortical development malformation	Pubtator	31675181	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	18727923, 31478236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12545165, 12759748, 14967153, 15201975, 16024604, 16740735, 16985061, 17016643, 19482022, 21380457, 22799310, 24590291, 26130675, 26986853, 27830358 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	16597321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	19801537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	31653132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	24329682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	10649492, 11118037, 12792785, 12813468, 12873722, 14661059, 17932950, 19826001, 20198346, 20861185, 22425986, 22693251, 28358928, 28982593, 9605766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22693251, 23010077, 28468949, 30405827, 3759102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	15674352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	23988121, 3397071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	17414053, 18951869, 21380457, 28455724, 29098877, 30075546, 30189188, 31031206, 31075798, 31464604, 31612067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12645648, 12873722, 16533763, 20861185, 21986563, 23376848, 24802742, 29322512, 31413735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	12813468, 23049225, 26239822, 26401016, 28052004, 28393243, 29285644, 31805343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	26401016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	31805343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12545165, 12792785, 17016643, 17418982, 17521951, 17979893, 18593873, 18648664, 18923442, 18951869, 19101688, 19402793, 19912643, 20822092, 20882354 View all (33 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CTD_human_DG	21455586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	19446743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18288400, 22139079, 23010077, 23783552, 24604602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	Pubtator	26241963	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	16597321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	12545165, 15201975, 16048908, 24590291, 28878029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12545165, 14967153, 18974116, 19108738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	16597321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	16597321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	15712180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Megaloblastic Anemia 1	Anemia	BEFREE	7703038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	24557030	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	BEFREE	30266136		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	32214200, 35805888	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma Cutaneous Malignant	Melanoma	Pubtator	24557030	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	18981889, 27614886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	LHGDN	18981889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	27614886	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningomyelocele	Meningomyelocele	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	25268936, 30809196, 401356, 431798, 760696, 8267107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	4038761, 6745954, 8267107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	28282855, 30820874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	28282855	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	23016887	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	28710952, 29079835, 29679027, 30737047, 31667610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	23376848, 29212270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microangiopathic hemolytic anemia	Microangiopathic hemolytic anemia	BEFREE	28662310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microangiopathy, Diabetic	Diabetic cardiomyopathy	CTD_human_DG	16597321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	29325993, 31715011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	29611101, 3463534, 6455458, 6512712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	PSYGENET_DG	6455458, 6512712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	3361338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor neuron disease	Pubtator	3361338	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	30987719	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya Disease	BEFREE	28843803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya disease 1	Moyamoya disease	BEFREE	28843803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	10809897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 2a	Multiple Endocrine Neoplasia	BEFREE	2873080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	16489177, 18923442, 30651846, 31683939, 3378797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	16489177, 18923442, 23285118	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	27807673, 31317818, 31675181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	31675181, 33919169, 37299978	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	31317818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Atrophy Spinal	Spinal muscular atrophy	Pubtator	3361338	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	28440464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	2776732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelocele	Myelocele	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	20376581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	28324773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	12888904, 19543515, 22576927, 3397067, 3460960		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	12941748, 17525367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	16597321, 17068284, 17207726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	17525367, 19490627, 21767674, 27913007, 29896420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	17525367, 22403646, 30646354	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	19455468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	16680376, 16862168, 18627284, 19404920, 23588806, 23908159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	19404920, 20473931, 21535891, 33215427	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10649492, 12034501, 12531887, 12545165, 12645648, 12759748, 12792785, 12873722, 14647417, 14661059, 15159023, 15201975, 15712180, 16489177, 16533763 View all (90 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CTD_human_DG	21455586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	31157195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	30415495		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neural Tube Defects	Neural tube defect	Pubtator	30415495	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	BEFREE	31588929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	19444643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	18760271, 28430371, 30453660, 30820874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	14661059, 17932950, 22693251, 24082123, 28356990, 29113240, 31059015, 31770531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	29411270, 30586008, 30820874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	18807107, 24868113, 28282855, 29544751, 30737047, 30860476		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	19440331, 24868113, 25493023, 28068899, 28282855	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	20017911, 25096020, 27353603	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	30278072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	26617706	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteogenesis Imperfecta	Osteogenesis imperfecta	Pubtator	24612500	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	31663278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	31663278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	LHGDN	11565553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	23988121, 3397071		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Hyperstimulation Syndrome	Ovarian Hyperstimulation Syndrome	BEFREE	28534980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian hyperstimulation syndrome	Pubtator	28534980	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	10649492, 6843722		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	15674352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	16270321, 19487548, 23988121, 24576319, 26211665, 31315664, 32316405, 34071861	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	17414053, 18951869, 21380457, 28455724, 29098877, 30075546, 30189188, 31031206, 31075798, 31464604, 31612067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	23681804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	18951869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	24349355	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	24571389	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	26897254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	20376581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	2280371, 2322088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	17918239, 26228081, 29454662, 31604369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	LHGDN	17918239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	26228081, 27349967	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	20376581, 29138283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	23681804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	28008865, 30860476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	30414552		★★★★★ ★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	27903615, 28758129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	31626097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polar cataract	Cataract	BEFREE	3456204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis	Polyarthritis	CTD_human_DG	16597321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis	Polyarthritis	BEFREE	4029960		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	2821260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	19440331, 24397393, 28534980, 28900795	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	28900795, 31667610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	21507405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	3972421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	28324773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	17357835, 30269440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	28758129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12873722, 16533763, 18369381, 21986563, 23376848, 24802742, 29322512, 31413735, 6596192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	12545165, 12645648, 12873722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23563546, 32753660, 38415559	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
prostatitis	Prostatitis	BEFREE	30995113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	822772	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	21087091, 27571879, 71831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	28627459	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	19023114, 30231995	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29069014, 30231995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	33108241, 34673346, 35011566	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Purpura, Thrombotic Thrombocytopenic	Thrombotic thrombocytopenic purpura	BEFREE	31205845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	17016643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	BEFREE	17016643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	17029774, 19380190, 2917316, 6202894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	31133447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	29330058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	30232287, 31573976, 31639229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	29330058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	24884814	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Willis-ekbom disease	Pubtator	30244532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal Detachment	CTD_human_DG	16597321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	17275123, 21555971, 28758129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Pigment Epithelial Detachment	Retinal Pigment Epithelial Detachment	CTD_human_DG	16597321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	23701120, 24863583, 27483410, 28894708, 4029960, 9506881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rosacea	Rosacea	Pubtator	32293942	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	17446058	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	21430262	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	21860221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	34673346	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	11600184, 16897611, 30972627, 31473906, 3857216		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	CTD_human_DG	18583979		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASDB_DG	21926974		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	29249827	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seizures	Seizures	Pubtator	18554871	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	31568522	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	17081067, 26344008, 26727089, 30365067, 30625342, 31573976, 31639229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	12938813, 29522771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Specific granule deficiency	Specific Granule Deficiency	BEFREE	16543473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spina Bifida Occulta	Spina bifida occulta	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Splenomegaly	Splenomegaly	Pubtator	822772	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	29463951, 29780803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22002576, 34051764	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	27174913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	23625658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	15159023, 19743954, 20417195, 28468949, 31478236		★★★★★ ★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	28837209, 29680345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	22011804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	28430371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	12813468, 23049225, 26239822, 26401016, 28052004, 28393243, 29285644, 31805343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	12813468		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	19116449, 23049225, 2709394, 28052004, 34933074, 35578189, 36173625	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	26239822	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	26401016		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stroke	Stroke	Pubtator	24994788	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	16436647, 23842553, 24286153, 26348010, 29104730, 29902601, 29904350, 30057687, 30952792, 31454333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	20943062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thalassemia	Thalassemia	Pubtator	29365317	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	BEFREE	11823983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombotic Microangiopathies	Thrombotic Microangiopathies	BEFREE	28596204, 28662310, 28774273, 29550758, 30569313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Tricuspid Valve Insufficiency	Tricuspid Valve Insufficiency	BEFREE	26337933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tricuspid Valve Insufficiency	Tricuspid valve disease	Pubtator	26337933	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	23167376, 38305604	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29973594, 30804365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	27693318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	6745954, 7506108, 8267107, 9017976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	PSYGENET_DG	6745954, 7506108, 8267107, 9017976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	23464404, 24577895, 29963784, 32620920, 6221102	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	23510351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	BEFREE	30206455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	11909563, 14734126, 18691072, 22465143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis Leukocytoclastic Cutaneous	Vasculitis	Pubtator	23625658	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasospasm Intracranial	Intracranial vasospasm	Pubtator	25583472	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

DLC1 (DLC1 Rho GTPase activating protein)