Gene Gene information from NCBI Gene database.
Entrez ID 10389
Gene name Scm polycomb group protein like 2
Gene symbol SCML2
Synonyms (NCBI Gene)
-
Chromosome X
Chromosome location Xp22.13
Summary This gene encodes a member of the Polycomb group proteins. These proteins form the Polycomb repressive complexes which are involved in transcriptional repression. The encoded protein binds histone peptides that are monomethylated at lysine residues and ma
miRNA miRNA information provided by mirtarbase database.
411
miRTarBase ID miRNA Experiments Reference
MIRT019241 hsa-miR-331-3p Sequencing 20371350
MIRT019552 hsa-miR-340-5p Sequencing 20371350
MIRT030462 hsa-miR-24-3p Sequencing 20371350
MIRT052303 hsa-let-7b-5p CLASH 23622248
MIRT049207 hsa-miR-92a-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10
GO ID Ontology Definition Evidence Reference
GO:0003682 Function Chromatin binding IBA
GO:0005515 Function Protein binding IPI 24358021, 32296183
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 21282530
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300208 10581 ENSG00000102098
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UQR0
Protein name Sex comb on midleg-like protein 2
Protein function Putative Polycomb group (PcG) protein. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development (By similarity).
PDB 1OI1 , 2BIV , 2MEM , 2VYT , 4EDU
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02820 MBT 67 135 mbt repeat Domain
PF02820 MBT 176 243 mbt repeat Domain
PF17208 RBR 277 324 RNA binding Region Family
PF12140 SLED 356 465 SLED domain Domain
PF00536 SAM_1 629 695 SAM domain (Sterile alpha motif) Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in placenta, thymus and testis. Detected at lower levels in brain, liver, skeletal muscle, pancreas and ovary. {ECO:0000269|PubMed:10331946}.
Sequence
MGQTVNEDSMDVKKENQEKTPQSSTSSVQRDDFHWEEYLKETGSISAPSECFRQSQIPPV
NDFKVGMKLEARDPRNATSVCIATVIGITGARLRLRLDGSDNRNDFWRLVDSPDIQPVGT
CEKEGDLLQPPLGYQ
MNTSSWPMFLLKTLNGSEMASATLFKKEPPKPPLNNFKVGMKLEA
IDKKNPYLICPATIGDVKGDEVHITFDGWSGAFDYWCKYDSRDIFPAGWCRLTGDVLQPP
GTS
VPIVKNIAKTESSPSEASQHSMQSPQKTTLILPTQQVRRSSRIKPPGPTAVPKRSSS
VKNITPRKKGPNSGKKEKPLPVIC
STSAASLKSLTRDRGMLYKDVASGPCKIVMSTVCVY
VNKHGNFGPHLDPKRIQQLPDHFGPGPVNVVLRRIVQACVDCALETKTVFGYLKPDNRGG
EVITASFDGETHSIQLPPVNSASFALRFLENFCHSLQCDNLLSSQ
PFSSSRGHTHSSAEH
DKNQSAKEDVTERQSTKRSPQQTVPYVVPLSPKLPKTKEYASEGEPLFAGGSAIPKEENL
SEDSKSSSLNSGNYLNPACRNPMYIHTSVSQDFSRSVPGTTSSPLVGDISPKSSPHEVKF
QMQRKSEAPSYIAVPDPSVLKQGFSKDPSTWSVDEVIQFMKHTDPQISGPLADLFRQHEI
DGKALFLLKSDVMMKYMGLKLGPALKLCYYIEKLK
EGKYS
Sequence length 700
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Polycomb repressive complex  
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
MEDULLOBLASTOMA CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1 Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adult Medulloblastoma Medulloblastoma CTD_human_DG 19270706
★☆☆☆☆
Found in Text Mining only
Brain Neoplasms Brain neoplasms Pubtator 12952983, 24727478 Associate
★☆☆☆☆
Found in Text Mining only
Childhood Medulloblastoma Medulloblastoma CTD_human_DG 19270706
★☆☆☆☆
Found in Text Mining only
Desmoplastic Medulloblastoma Medulloblastoma CTD_human_DG 19270706
★☆☆☆☆
Found in Text Mining only
Gastro-enteropancreatic neuroendocrine tumor Digestive system neuroendocrine neoplasm BEFREE 28810646
★☆☆☆☆
Found in Text Mining only
Infertility Male Male infertility Pubtator 39267058 Associate
★☆☆☆☆
Found in Text Mining only
Medulloblastoma Medulloblastoma CTD_human_DG 19270706
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Medullomyoblastoma Medullomyoblastoma CTD_human_DG 19270706
★☆☆☆☆
Found in Text Mining only
Melanotic medulloblastoma Medulloblastoma CTD_human_DG 19270706
★☆☆☆☆
Found in Text Mining only
Neoplasms Neoplasms BEFREE 28810646
★☆☆☆☆
Found in Text Mining only