Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10379
Gene name	Interferon regulatory factor 9
Gene symbol	IRF9
Synonyms (NCBI Gene)	IRF-9ISGF3ISGF3Gp48
Chromosome	14
Chromosome location	14q12
Summary	This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune syst

Show/Hide all (2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1594389703	G>T	Risk-factor	Splice donor variant
rs1594390415	G>A	Risk-factor	Missense variant, coding sequence variant

153

Show/Hide all (153)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004628	hsa-miR-342-3p	Review	20026422
MIRT020418	hsa-miR-106b-5p	Microarray	17242205
MIRT190679	hsa-miR-373-3p	ImmunoprecipitaionqRT-PCRLuciferase reporter assayWestern blot	25589644
MIRT190679	hsa-miR-373-3p	ImmunoprecipitaionqRT-PCRLuciferase reporter assayWestern blot	25589644
MIRT1071465	hsa-miR-106a	CLIP-seq
MIRT1071466	hsa-miR-106b	CLIP-seq
MIRT1071467	hsa-miR-1197	CLIP-seq
MIRT1071468	hsa-miR-1226	CLIP-seq
MIRT1071469	hsa-miR-1245b-3p	CLIP-seq
MIRT1071470	hsa-miR-1290	CLIP-seq
MIRT1071471	hsa-miR-1294	CLIP-seq
MIRT1071472	hsa-miR-1303	CLIP-seq
MIRT1071473	hsa-miR-142-5p	CLIP-seq
MIRT1071474	hsa-miR-17	CLIP-seq
MIRT1071475	hsa-miR-199a-5p	CLIP-seq
MIRT1071476	hsa-miR-199b-5p	CLIP-seq
MIRT1071477	hsa-miR-20a	CLIP-seq
MIRT1071478	hsa-miR-20b	CLIP-seq
MIRT1071479	hsa-miR-2114	CLIP-seq
MIRT1071480	hsa-miR-302a	CLIP-seq
MIRT1071481	hsa-miR-302b	CLIP-seq
MIRT1071482	hsa-miR-302c	CLIP-seq
MIRT1071483	hsa-miR-302d	CLIP-seq
MIRT1071484	hsa-miR-302e	CLIP-seq
MIRT1071485	hsa-miR-3119	CLIP-seq
MIRT1071486	hsa-miR-3125	CLIP-seq
MIRT1071487	hsa-miR-3153	CLIP-seq
MIRT1071488	hsa-miR-3185	CLIP-seq
MIRT1071489	hsa-miR-331-3p	CLIP-seq
MIRT1071490	hsa-miR-340	CLIP-seq
MIRT1071491	hsa-miR-3606	CLIP-seq
MIRT1071492	hsa-miR-3609	CLIP-seq
MIRT1071493	hsa-miR-3611	CLIP-seq
MIRT1071494	hsa-miR-3614-3p	CLIP-seq
MIRT1071495	hsa-miR-3689a-3p	CLIP-seq
MIRT1071496	hsa-miR-3689c	CLIP-seq
MIRT1071497	hsa-miR-372	CLIP-seq
MIRT1071498	hsa-miR-373	CLIP-seq
MIRT1071499	hsa-miR-3916	CLIP-seq
MIRT1071500	hsa-miR-4251	CLIP-seq
MIRT1071501	hsa-miR-4259	CLIP-seq
MIRT1071502	hsa-miR-4270	CLIP-seq
MIRT1071503	hsa-miR-4292	CLIP-seq
MIRT1071504	hsa-miR-4302	CLIP-seq
MIRT1071505	hsa-miR-4313	CLIP-seq
MIRT1071506	hsa-miR-4425	CLIP-seq
MIRT1071507	hsa-miR-4428	CLIP-seq
MIRT1071508	hsa-miR-4436a	CLIP-seq
MIRT1071509	hsa-miR-4441	CLIP-seq
MIRT1071510	hsa-miR-4676-5p	CLIP-seq
MIRT1071511	hsa-miR-4710	CLIP-seq
MIRT1071512	hsa-miR-4719	CLIP-seq
MIRT1071513	hsa-miR-4728-5p	CLIP-seq
MIRT1071514	hsa-miR-4737	CLIP-seq
MIRT1071515	hsa-miR-4796-3p	CLIP-seq
MIRT1071516	hsa-miR-515-5p	CLIP-seq
MIRT1071517	hsa-miR-519d	CLIP-seq
MIRT1071518	hsa-miR-520a-3p	CLIP-seq
MIRT1071519	hsa-miR-520b	CLIP-seq
MIRT1071520	hsa-miR-520c-3p	CLIP-seq
MIRT1071521	hsa-miR-520d-3p	CLIP-seq
MIRT1071522	hsa-miR-520e	CLIP-seq
MIRT1071523	hsa-miR-520f	CLIP-seq
MIRT1071524	hsa-miR-548ah	CLIP-seq
MIRT1071525	hsa-miR-549	CLIP-seq
MIRT1071526	hsa-miR-554	CLIP-seq
MIRT1071527	hsa-miR-571	CLIP-seq
MIRT1071528	hsa-miR-575	CLIP-seq
MIRT1071529	hsa-miR-580	CLIP-seq
MIRT1071530	hsa-miR-583	CLIP-seq
MIRT1071531	hsa-miR-585	CLIP-seq
MIRT1071532	hsa-miR-600	CLIP-seq
MIRT1071533	hsa-miR-606	CLIP-seq
MIRT1071534	hsa-miR-627	CLIP-seq
MIRT1071535	hsa-miR-636	CLIP-seq
MIRT1071536	hsa-miR-921	CLIP-seq
MIRT1071537	hsa-miR-924	CLIP-seq
MIRT1071538	hsa-miR-93	CLIP-seq
MIRT1071539	hsa-miR-934	CLIP-seq
MIRT1071469	hsa-miR-1245b-3p	CLIP-seq
MIRT1071472	hsa-miR-1303	CLIP-seq
MIRT1071479	hsa-miR-2114	CLIP-seq
MIRT2017584	hsa-miR-3673	CLIP-seq
MIRT2017585	hsa-miR-3685	CLIP-seq
MIRT2017586	hsa-miR-384	CLIP-seq
MIRT1071526	hsa-miR-554	CLIP-seq
MIRT1071530	hsa-miR-583	CLIP-seq
MIRT1071531	hsa-miR-585	CLIP-seq
MIRT1071532	hsa-miR-600	CLIP-seq
MIRT1071467	hsa-miR-1197	CLIP-seq
MIRT1071468	hsa-miR-1226	CLIP-seq
MIRT1071469	hsa-miR-1245b-3p	CLIP-seq
MIRT1071470	hsa-miR-1290	CLIP-seq
MIRT1071475	hsa-miR-199a-5p	CLIP-seq
MIRT1071476	hsa-miR-199b-5p	CLIP-seq
MIRT1071479	hsa-miR-2114	CLIP-seq
MIRT2017584	hsa-miR-3673	CLIP-seq
MIRT2017585	hsa-miR-3685	CLIP-seq
MIRT2017586	hsa-miR-384	CLIP-seq
MIRT1071504	hsa-miR-4302	CLIP-seq
MIRT1071508	hsa-miR-4436a	CLIP-seq
MIRT1071510	hsa-miR-4676-5p	CLIP-seq
MIRT1071514	hsa-miR-4737	CLIP-seq
MIRT1071516	hsa-miR-515-5p	CLIP-seq
MIRT1071526	hsa-miR-554	CLIP-seq
MIRT1071528	hsa-miR-575	CLIP-seq
MIRT1071530	hsa-miR-583	CLIP-seq
MIRT1071532	hsa-miR-600	CLIP-seq
MIRT1071468	hsa-miR-1226	CLIP-seq
MIRT1071470	hsa-miR-1290	CLIP-seq
MIRT1071475	hsa-miR-199a-5p	CLIP-seq
MIRT1071476	hsa-miR-199b-5p	CLIP-seq
MIRT1071502	hsa-miR-4270	CLIP-seq
MIRT1071504	hsa-miR-4302	CLIP-seq
MIRT1071509	hsa-miR-4441	CLIP-seq
MIRT1071510	hsa-miR-4676-5p	CLIP-seq
MIRT1071514	hsa-miR-4737	CLIP-seq
MIRT1071528	hsa-miR-575	CLIP-seq
MIRT1071530	hsa-miR-583	CLIP-seq
MIRT1071471	hsa-miR-1294	CLIP-seq
MIRT1071488	hsa-miR-3185	CLIP-seq
MIRT2553000	hsa-miR-3190	CLIP-seq
MIRT1071493	hsa-miR-3611	CLIP-seq
MIRT2553001	hsa-miR-361-3p	CLIP-seq
MIRT2553002	hsa-miR-4426	CLIP-seq
MIRT1071507	hsa-miR-4428	CLIP-seq
MIRT2553003	hsa-miR-4647	CLIP-seq
MIRT2553004	hsa-miR-4662b	CLIP-seq
MIRT1071511	hsa-miR-4710	CLIP-seq
MIRT1071512	hsa-miR-4719	CLIP-seq
MIRT1071529	hsa-miR-580	CLIP-seq
MIRT1071530	hsa-miR-583	CLIP-seq
MIRT1071534	hsa-miR-627	CLIP-seq
MIRT2553005	hsa-miR-7	CLIP-seq
MIRT1071537	hsa-miR-924	CLIP-seq
MIRT1071539	hsa-miR-934	CLIP-seq
MIRT1071471	hsa-miR-1294	CLIP-seq
MIRT1071488	hsa-miR-3185	CLIP-seq
MIRT2553000	hsa-miR-3190	CLIP-seq
MIRT1071493	hsa-miR-3611	CLIP-seq
MIRT2553001	hsa-miR-361-3p	CLIP-seq
MIRT2553002	hsa-miR-4426	CLIP-seq
MIRT1071507	hsa-miR-4428	CLIP-seq
MIRT2553003	hsa-miR-4647	CLIP-seq
MIRT2553004	hsa-miR-4662b	CLIP-seq
MIRT1071511	hsa-miR-4710	CLIP-seq
MIRT1071512	hsa-miR-4719	CLIP-seq
MIRT1071529	hsa-miR-580	CLIP-seq
MIRT1071530	hsa-miR-583	CLIP-seq
MIRT1071534	hsa-miR-627	CLIP-seq
MIRT2553005	hsa-miR-7	CLIP-seq
MIRT1071537	hsa-miR-924	CLIP-seq
MIRT1071539	hsa-miR-934	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
BRCA1	Activation	12212615

Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IMP	24882218
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0002376	Process	Immune system process	IBA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	1630447
GO:0005515	Function	Protein binding	IPI	17923090, 21903422, 24065129, 28514442, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	1630447
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	1630447
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006366	Process	Transcription by RNA polymerase II	TAS	1630447
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	1630447
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	24065129
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0051607	Process	Defense response to virus	IEA
GO:0070721	Component	ISGF3 complex	IPI	24065129
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
147574	6131	ENSG00000213928

Q00978

Protein name

Interferon regulatory factor 9 (IRF-9) (IFN-alpha-responsive transcription factor subunit) (ISGF3 p48 subunit) (Interferon-stimulated gene factor 3 gamma) (ISGF-3 gamma) (Transcriptional regulator ISGF3 subunit gamma)

Protein function

Transcription factor that plays an essential role in anti-viral immunity. It mediates signaling by type I IFNs (IFN-alpha and IFN-beta). Following type I IFN binding to cell surface receptors, Jak kinases (TYK2 and JAK1) are activated, leading t

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00605	IRF	11 → 115	Interferon regulatory factor transcription factor	Domain
PF10401	IRF-3	217 → 383	Interferon-regulatory factor 3	Family

Sequence

MASGRARCTRKLRNWVVEQVESGQFPGVCWDDTAKTMFRIPWKHAGKQDFREDQDAAFFK
AWAIFKGKYKEGDTGGPAVWKTRLRCALNKSSEFKEVPERGRMDVAEPYKVYQLLPPGIV
SGQPGTQKVPSKRQHSSVSSERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIG
SSSSSSSPEPQEVTDTTEAPFQGDQRSLEFLLPPEPDYSLLLTFIYNGRVVGEAQVQSLD
CRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLERGILVASNPRGLFVQRLCPIPISW
NAPQAPPGPGPHLLPSNECVELFRTAYFCRDLVRYFQGLGPPPKFQVTLNFWEESHGSSH
TPQNLITVKMEQAFARYLLEQTPEQQAAILSLV

Sequence length

393

Interactions

View interactions

	KEGG		Reactome
	Necroptosis Osteoclast differentiation Toll-like receptor signaling pathway NOD-like receptor signaling pathway C-type lectin receptor signaling pathway JAK-STAT signaling pathway Hepatitis C Measles Influenza A Human papillomavirus infection Kaposi sarcoma-associated herpesvirus infection Herpes simplex virus 1 infection Epstein-Barr virus infection Coronavirus disease - COVID-19 Viral carcinogenesis		Interferon gamma signaling Interferon alpha/beta signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immunodeficiency 65, susceptibility to viral infections	Uncertain significance; risk factor	ClinVar ClinVar, Disgenet, GWAS catalog, HPO ClinVar, Disgenet, GWAS catalog, HPO ClinVar, Disgenet, GWAS catalog, HPO	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
IRF9-related disorder	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (63)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	10694514, 9186002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	34918636	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30728464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	39234946	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	11522652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11522652, 26081906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26081906	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35617355	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	10497156, 16948122	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	39457004	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31821170, 35995140	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	25186738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	12972432, 30679726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	30679726	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12972432	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	19032371, 30355451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	37353938	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	35993041	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	39350187	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	12169689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21098709, 26081906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21098709, 26081906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	21098709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33902005	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	11106638	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	39339845	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	25186738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	17431130	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	28213966, 29501566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	39743791	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	28318807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	35182547	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11522652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	10768861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23913484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28374495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10882109, 12748307, 31841696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	12972432		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	19032371, 23598529, 28560754, 9353349, 9605150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	35148998, 9353349	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10768861, 11522652, 19715403, 25154617, 26081906, 29229854, 30355451		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	28213522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	34312772	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	17971902	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	35012444	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	Pubtator	35609018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23913484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23913484	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	19032371, 30355451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	29504848, 36132546	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	12748307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28714361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35664436	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28374495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20507321, 32867271	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	29480757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29229854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	11739693	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	39958336	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma Pigmentosum	BEFREE	10882109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma pigmentosum	Pubtator	9892649	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum Complementation Group E	Xeroderma pigmentosum	Pubtator	11705987, 12170778, 9892649	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
XERODERMA PIGMENTOSUM, COMPLEMENTATION GROUP E	Xeroderma Pigmentosum	BEFREE	10882109, 8798680, 9632823, 9892649		★★★★★ ★☆☆☆☆ Found in Text Mining only

IRF9 (interferon regulatory factor 9)