KLF2 (KLF transcription factor 2)

Gene

• Entrez ID: 10365
• Gene name: KLF transcription factor 2
• Gene symbol: KLF2
• Synonyms (NCBI Gene): LKLF
• Chromosome: 19
• Chromosome location: 19p13.11
• Summary: This gene encodes a protein that belongs to the Kruppel family of transcription factors. The encoded zinc finger protein is expressed early in mammalian development and is found in many different cell types. The protein acts to bind the CACCC box found in

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006372	hsa-miR-92a-3p	Luciferase reporter assay	21768538
MIRT006372	hsa-miR-92a-3p	Luciferase reporter assay	21768538
MIRT006372	hsa-miR-92a-3p	Luciferase reporter assay	21768538
MIRT023028	hsa-miR-124-3p	Microarray	18668037
MIRT006372	hsa-miR-92a-3p	Other	21768538
MIRT719862	hsa-miR-1228-3p	HITS-CLIP	19536157
MIRT719861	hsa-miR-4301	HITS-CLIP	19536157
MIRT719860	hsa-miR-5193	HITS-CLIP	19536157
MIRT719859	hsa-miR-660-3p	HITS-CLIP	19536157
MIRT719858	hsa-miR-532-3p	HITS-CLIP	19536157
MIRT719857	hsa-miR-377-3p	HITS-CLIP	19536157
MIRT719856	hsa-miR-3156-3p	HITS-CLIP	19536157
MIRT719855	hsa-miR-4691-5p	HITS-CLIP	19536157
MIRT719853	hsa-miR-6792-3p	HITS-CLIP	19536157
MIRT719854	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT719862	hsa-miR-1228-3p	HITS-CLIP	19536157
MIRT719861	hsa-miR-4301	HITS-CLIP	19536157
MIRT719860	hsa-miR-5193	HITS-CLIP	19536157
MIRT719859	hsa-miR-660-3p	HITS-CLIP	19536157
MIRT719858	hsa-miR-532-3p	HITS-CLIP	19536157
MIRT719857	hsa-miR-377-3p	HITS-CLIP	19536157
MIRT719856	hsa-miR-3156-3p	HITS-CLIP	19536157
MIRT719855	hsa-miR-4691-5p	HITS-CLIP	19536157
MIRT719853	hsa-miR-6792-3p	HITS-CLIP	19536157
MIRT719854	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT650273	hsa-miR-7110-3p	HITS-CLIP	19536157
MIRT711854	hsa-miR-6817-3p	HITS-CLIP	19536157
MIRT650272	hsa-miR-6515-3p	HITS-CLIP	19536157
MIRT650271	hsa-miR-1236-3p	HITS-CLIP	19536157
MIRT650270	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT650269	hsa-miR-6873-3p	HITS-CLIP	19536157
MIRT650267	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT650266	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT650265	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT687716	hsa-miR-548c-3p	HITS-CLIP	23313552
MIRT687715	hsa-miR-4668-3p	HITS-CLIP	23313552
MIRT687714	hsa-miR-6771-3p	HITS-CLIP	23313552
MIRT687713	hsa-miR-942-3p	HITS-CLIP	23313552
MIRT687712	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT687711	hsa-miR-3926	HITS-CLIP	23313552
MIRT687710	hsa-miR-548s	HITS-CLIP	23313552
MIRT673885	hsa-miR-4797-5p	HITS-CLIP	23824327
MIRT673886	hsa-miR-5007-5p	HITS-CLIP	23824327
MIRT673884	hsa-miR-3155a	HITS-CLIP	23824327
MIRT673883	hsa-miR-3155b	HITS-CLIP	23824327
MIRT673882	hsa-miR-484	HITS-CLIP	23824327
MIRT673880	hsa-miR-6812-3p	HITS-CLIP	23824327
MIRT673881	hsa-miR-3664-3p	HITS-CLIP	23824327
MIRT673879	hsa-miR-1266-5p	HITS-CLIP	23824327
MIRT673877	hsa-miR-4518	HITS-CLIP	23824327
MIRT673878	hsa-miR-3120-5p	HITS-CLIP	23824327
MIRT673876	hsa-miR-4524a-3p	HITS-CLIP	23824327
MIRT673875	hsa-miR-6895-3p	HITS-CLIP	23824327
MIRT673874	hsa-miR-593-3p	HITS-CLIP	23824327
MIRT673873	hsa-miR-6888-3p	HITS-CLIP	23824327
MIRT673871	hsa-miR-3672	HITS-CLIP	23824327
MIRT673872	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT673870	hsa-miR-6818-3p	HITS-CLIP	23824327
MIRT673869	hsa-miR-8055	HITS-CLIP	23824327
MIRT532248	hsa-miR-548aa	HITS-CLIP	23824327
MIRT532247	hsa-miR-548ap-3p	HITS-CLIP	23824327
MIRT532246	hsa-miR-548t-3p	HITS-CLIP	23824327
MIRT532245	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT532244	hsa-miR-548at-3p	HITS-CLIP	23824327
MIRT532243	hsa-miR-548ay-3p	HITS-CLIP	23824327
MIRT650277	hsa-miR-6865-3p	HITS-CLIP	23824327
MIRT650278	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT650276	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT532234	hsa-miR-412-3p	HITS-CLIP	23824327
MIRT532233	hsa-miR-6754-3p	HITS-CLIP	23824327
MIRT665001	hsa-miR-5591-3p	HITS-CLIP	23824327
MIRT650275	hsa-miR-1305	HITS-CLIP	23824327
MIRT665000	hsa-miR-2681-5p	HITS-CLIP	23824327
MIRT532248	hsa-miR-548aa	HITS-CLIP	23824327
MIRT532247	hsa-miR-548ap-3p	HITS-CLIP	23824327
MIRT532246	hsa-miR-548t-3p	HITS-CLIP	23824327
MIRT532245	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT532244	hsa-miR-548at-3p	HITS-CLIP	23824327
MIRT532243	hsa-miR-548ay-3p	HITS-CLIP	23824327
MIRT650277	hsa-miR-6865-3p	HITS-CLIP	23824327
MIRT650278	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT650276	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT532234	hsa-miR-412-3p	HITS-CLIP	23824327
MIRT532233	hsa-miR-6754-3p	HITS-CLIP	23824327
MIRT532229	hsa-miR-6802-3p	HITS-CLIP	23824327
MIRT650275	hsa-miR-1305	HITS-CLIP	23824327
MIRT650274	hsa-miR-6840-5p	HITS-CLIP	23824327
MIRT650273	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT650272	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT650271	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT650270	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT650269	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT650268	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT650267	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT650266	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT650265	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT532248	hsa-miR-548aa	PAR-CLIP	22012620
MIRT532247	hsa-miR-548ap-3p	PAR-CLIP	22012620
MIRT532246	hsa-miR-548t-3p	PAR-CLIP	22012620
MIRT532245	hsa-miR-548as-3p	PAR-CLIP	22012620
MIRT532244	hsa-miR-548at-3p	PAR-CLIP	22012620
MIRT532243	hsa-miR-548ay-3p	PAR-CLIP	22012620
MIRT532242	hsa-miR-1285-5p	PAR-CLIP	22012620
MIRT532241	hsa-miR-6715a-3p	PAR-CLIP	22012620
MIRT532240	hsa-miR-454-5p	PAR-CLIP	22012620
MIRT532239	hsa-miR-371b-5p	PAR-CLIP	22012620
MIRT532238	hsa-miR-373-5p	PAR-CLIP	22012620
MIRT532237	hsa-miR-616-5p	PAR-CLIP	22012620
MIRT532236	hsa-miR-371a-5p	PAR-CLIP	22012620
MIRT532235	hsa-miR-372-5p	PAR-CLIP	22012620
MIRT532234	hsa-miR-412-3p	PAR-CLIP	22012620
MIRT532233	hsa-miR-6754-3p	PAR-CLIP	22012620
MIRT532232	hsa-miR-4786-5p	PAR-CLIP	22012620
MIRT532231	hsa-miR-769-5p	PAR-CLIP	22012620
MIRT532230	hsa-miR-6715b-3p	PAR-CLIP	22012620
MIRT532229	hsa-miR-6802-3p	PAR-CLIP	22012620
MIRT474624	hsa-miR-6808-5p	PAR-CLIP	23446348
MIRT474623	hsa-miR-6893-5p	PAR-CLIP	23446348
MIRT474622	hsa-miR-940	PAR-CLIP	23446348
MIRT474621	hsa-miR-4459	PAR-CLIP	23446348
MIRT474620	hsa-miR-665	PAR-CLIP	23446348
MIRT474619	hsa-miR-6840-3p	PAR-CLIP	23446348
MIRT474617	hsa-miR-1827	PAR-CLIP	23446348
MIRT474615	hsa-miR-4722-5p	PAR-CLIP	23446348
MIRT474616	hsa-miR-6894-5p	PAR-CLIP	23446348
MIRT474624	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT474623	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT474622	hsa-miR-940	PAR-CLIP	23592263
MIRT474621	hsa-miR-4459	PAR-CLIP	23592263
MIRT474620	hsa-miR-665	PAR-CLIP	23592263
MIRT474619	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT474618	hsa-miR-4649-3p	PAR-CLIP	23592263
MIRT474617	hsa-miR-1827	PAR-CLIP	23592263
MIRT474615	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT474616	hsa-miR-6894-5p	PAR-CLIP	23592263
MIRT474614	hsa-miR-1273e	PAR-CLIP	23592263
MIRT006372	hsa-miR-92a-3p	Immunohistochemistry, qRT-PCR, Western blot	27411964
MIRT006372	hsa-miR-92a-3p	Immunohistochemistry, qRT-PCR, Western blot	27411964
MIRT474614	hsa-miR-1273e	PAR-CLIP	27292025
MIRT474614	hsa-miR-1273e	PAR-CLIP	27292025
MIRT474617	hsa-miR-1827	PAR-CLIP	27292025
MIRT474621	hsa-miR-4459	PAR-CLIP	27292025
MIRT474620	hsa-miR-665	PAR-CLIP	27292025
MIRT474619	hsa-miR-6840-3p	PAR-CLIP	27292025
MIRT474619	hsa-miR-6840-3p	PAR-CLIP	27292025
MIRT733413	hsa-miR-15b-3p	qRT-PCR, Western blotting	34224334
MIRT736061	hsa-miR-32-5p	Luciferase reporter assay, Western blotting	31497207
MIRT719862	hsa-miR-1228-3p	HITS-CLIP	19536157
MIRT719861	hsa-miR-4301	HITS-CLIP	19536157
MIRT719860	hsa-miR-5193	HITS-CLIP	19536157
MIRT719859	hsa-miR-660-3p	HITS-CLIP	19536157
MIRT719858	hsa-miR-532-3p	HITS-CLIP	19536157
MIRT719857	hsa-miR-377-3p	HITS-CLIP	19536157
MIRT719856	hsa-miR-3156-3p	HITS-CLIP	19536157
MIRT719855	hsa-miR-4691-5p	HITS-CLIP	19536157
MIRT719853	hsa-miR-6792-3p	HITS-CLIP	19536157
MIRT719854	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT719862	hsa-miR-1228-3p	HITS-CLIP	19536157
MIRT719861	hsa-miR-4301	HITS-CLIP	19536157
MIRT719860	hsa-miR-5193	HITS-CLIP	19536157
MIRT719859	hsa-miR-660-3p	HITS-CLIP	19536157
MIRT719858	hsa-miR-532-3p	HITS-CLIP	19536157
MIRT719857	hsa-miR-377-3p	HITS-CLIP	19536157
MIRT719856	hsa-miR-3156-3p	HITS-CLIP	19536157
MIRT719855	hsa-miR-4691-5p	HITS-CLIP	19536157
MIRT719853	hsa-miR-6792-3p	HITS-CLIP	19536157
MIRT719854	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT650273	hsa-miR-7110-3p	HITS-CLIP	19536157
MIRT711854	hsa-miR-6817-3p	HITS-CLIP	19536157
MIRT650272	hsa-miR-6515-3p	HITS-CLIP	19536157
MIRT650271	hsa-miR-1236-3p	HITS-CLIP	19536157
MIRT650270	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT650269	hsa-miR-6873-3p	HITS-CLIP	19536157
MIRT650267	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT650266	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT650265	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT687716	hsa-miR-548c-3p	HITS-CLIP	23313552
MIRT687715	hsa-miR-4668-3p	HITS-CLIP	23313552
MIRT687714	hsa-miR-6771-3p	HITS-CLIP	23313552
MIRT687713	hsa-miR-942-3p	HITS-CLIP	23313552
MIRT687712	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT687711	hsa-miR-3926	HITS-CLIP	23313552
MIRT687710	hsa-miR-548s	HITS-CLIP	23313552
MIRT673885	hsa-miR-4797-5p	HITS-CLIP	23824327
MIRT673886	hsa-miR-5007-5p	HITS-CLIP	23824327
MIRT673884	hsa-miR-3155a	HITS-CLIP	23824327
MIRT673883	hsa-miR-3155b	HITS-CLIP	23824327
MIRT673882	hsa-miR-484	HITS-CLIP	23824327
MIRT673880	hsa-miR-6812-3p	HITS-CLIP	23824327
MIRT673881	hsa-miR-3664-3p	HITS-CLIP	23824327
MIRT673879	hsa-miR-1266-5p	HITS-CLIP	23824327
MIRT673877	hsa-miR-4518	HITS-CLIP	23824327
MIRT673878	hsa-miR-3120-5p	HITS-CLIP	23824327
MIRT673876	hsa-miR-4524a-3p	HITS-CLIP	23824327
MIRT673875	hsa-miR-6895-3p	HITS-CLIP	23824327
MIRT673874	hsa-miR-593-3p	HITS-CLIP	23824327
MIRT673873	hsa-miR-6888-3p	HITS-CLIP	23824327
MIRT673871	hsa-miR-3672	HITS-CLIP	23824327
MIRT673872	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT673870	hsa-miR-6818-3p	HITS-CLIP	23824327
MIRT673869	hsa-miR-8055	HITS-CLIP	23824327
MIRT532248	hsa-miR-548aa	HITS-CLIP	23824327
MIRT532247	hsa-miR-548ap-3p	HITS-CLIP	23824327
MIRT532246	hsa-miR-548t-3p	HITS-CLIP	23824327
MIRT532245	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT532244	hsa-miR-548at-3p	HITS-CLIP	23824327
MIRT532243	hsa-miR-548ay-3p	HITS-CLIP	23824327
MIRT650277	hsa-miR-6865-3p	HITS-CLIP	23824327
MIRT650278	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT650276	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT532234	hsa-miR-412-3p	HITS-CLIP	23824327
MIRT532233	hsa-miR-6754-3p	HITS-CLIP	23824327
MIRT665001	hsa-miR-5591-3p	HITS-CLIP	23824327
MIRT650275	hsa-miR-1305	HITS-CLIP	23824327
MIRT665000	hsa-miR-2681-5p	HITS-CLIP	23824327
MIRT532248	hsa-miR-548aa	HITS-CLIP	23824327
MIRT532247	hsa-miR-548ap-3p	HITS-CLIP	23824327
MIRT532246	hsa-miR-548t-3p	HITS-CLIP	23824327
MIRT532245	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT532244	hsa-miR-548at-3p	HITS-CLIP	23824327
MIRT532243	hsa-miR-548ay-3p	HITS-CLIP	23824327
MIRT650277	hsa-miR-6865-3p	HITS-CLIP	23824327
MIRT650278	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT650276	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT532234	hsa-miR-412-3p	HITS-CLIP	23824327
MIRT532233	hsa-miR-6754-3p	HITS-CLIP	23824327
MIRT532229	hsa-miR-6802-3p	HITS-CLIP	23824327
MIRT650275	hsa-miR-1305	HITS-CLIP	23824327
MIRT650274	hsa-miR-6840-5p	HITS-CLIP	23824327
MIRT650273	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT650272	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT650271	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT650270	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT650269	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT650268	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT650267	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT650266	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT650265	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT532248	hsa-miR-548aa	PAR-CLIP	22012620
MIRT532247	hsa-miR-548ap-3p	PAR-CLIP	22012620
MIRT532246	hsa-miR-548t-3p	PAR-CLIP	22012620
MIRT532245	hsa-miR-548as-3p	PAR-CLIP	22012620
MIRT532244	hsa-miR-548at-3p	PAR-CLIP	22012620
MIRT532243	hsa-miR-548ay-3p	PAR-CLIP	22012620
MIRT532242	hsa-miR-1285-5p	PAR-CLIP	22012620
MIRT532241	hsa-miR-6715a-3p	PAR-CLIP	22012620
MIRT532240	hsa-miR-454-5p	PAR-CLIP	22012620
MIRT532239	hsa-miR-371b-5p	PAR-CLIP	22012620
MIRT532238	hsa-miR-373-5p	PAR-CLIP	22012620
MIRT532237	hsa-miR-616-5p	PAR-CLIP	22012620
MIRT532236	hsa-miR-371a-5p	PAR-CLIP	22012620
MIRT532235	hsa-miR-372-5p	PAR-CLIP	22012620
MIRT532234	hsa-miR-412-3p	PAR-CLIP	22012620
MIRT532233	hsa-miR-6754-3p	PAR-CLIP	22012620
MIRT532232	hsa-miR-4786-5p	PAR-CLIP	22012620
MIRT532231	hsa-miR-769-5p	PAR-CLIP	22012620
MIRT532230	hsa-miR-6715b-3p	PAR-CLIP	22012620
MIRT532229	hsa-miR-6802-3p	PAR-CLIP	22012620
MIRT474624	hsa-miR-6808-5p	PAR-CLIP	23446348
MIRT474623	hsa-miR-6893-5p	PAR-CLIP	23446348
MIRT474622	hsa-miR-940	PAR-CLIP	23446348
MIRT474621	hsa-miR-4459	PAR-CLIP	23446348
MIRT474620	hsa-miR-665	PAR-CLIP	23446348
MIRT474619	hsa-miR-6840-3p	PAR-CLIP	23446348
MIRT474617	hsa-miR-1827	PAR-CLIP	23446348
MIRT474615	hsa-miR-4722-5p	PAR-CLIP	23446348
MIRT474616	hsa-miR-6894-5p	PAR-CLIP	23446348
MIRT474624	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT474623	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT474622	hsa-miR-940	PAR-CLIP	23592263
MIRT474621	hsa-miR-4459	PAR-CLIP	23592263
MIRT474620	hsa-miR-665	PAR-CLIP	23592263
MIRT474619	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT474618	hsa-miR-4649-3p	PAR-CLIP	23592263
MIRT474617	hsa-miR-1827	PAR-CLIP	23592263
MIRT474615	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT474616	hsa-miR-6894-5p	PAR-CLIP	23592263
MIRT474614	hsa-miR-1273e	PAR-CLIP	23592263
MIRT1096328	hsa-miR-101	CLIP-seq
MIRT1096329	hsa-miR-1253	CLIP-seq
MIRT1096330	hsa-miR-1324	CLIP-seq
MIRT1096331	hsa-miR-185	CLIP-seq
MIRT1096332	hsa-miR-300	CLIP-seq
MIRT1096333	hsa-miR-3122	CLIP-seq
MIRT1096334	hsa-miR-3163	CLIP-seq
MIRT1096335	hsa-miR-3166	CLIP-seq
MIRT1096336	hsa-miR-338-5p	CLIP-seq
MIRT1096337	hsa-miR-340	CLIP-seq
MIRT1096338	hsa-miR-3689a-3p	CLIP-seq
MIRT1096339	hsa-miR-3689c	CLIP-seq
MIRT1096340	hsa-miR-381	CLIP-seq
MIRT1096341	hsa-miR-3913-5p	CLIP-seq
MIRT1096342	hsa-miR-4280	CLIP-seq
MIRT1096343	hsa-miR-4306	CLIP-seq
MIRT1096344	hsa-miR-4644	CLIP-seq
MIRT1096345	hsa-miR-4645-3p	CLIP-seq
MIRT1096346	hsa-miR-4666-3p	CLIP-seq
MIRT1096347	hsa-miR-4704-3p	CLIP-seq
MIRT1096348	hsa-miR-4728-5p	CLIP-seq
MIRT1096349	hsa-miR-4783-3p	CLIP-seq
MIRT1096350	hsa-miR-656	CLIP-seq
MIRT1096332	hsa-miR-300	CLIP-seq
MIRT1096334	hsa-miR-3163	CLIP-seq
MIRT1096336	hsa-miR-338-5p	CLIP-seq
MIRT1096337	hsa-miR-340	CLIP-seq
MIRT1096340	hsa-miR-381	CLIP-seq
MIRT1096346	hsa-miR-4666-3p	CLIP-seq
MIRT1096350	hsa-miR-656	CLIP-seq
MIRT1096328	hsa-miR-101	CLIP-seq
MIRT2257046	hsa-miR-1229	CLIP-seq
MIRT1096329	hsa-miR-1253	CLIP-seq
MIRT2257047	hsa-miR-128	CLIP-seq
MIRT2257048	hsa-miR-1293	CLIP-seq
MIRT1096330	hsa-miR-1324	CLIP-seq
MIRT2257049	hsa-miR-137	CLIP-seq
MIRT2257050	hsa-miR-1538	CLIP-seq
MIRT2257051	hsa-miR-2117	CLIP-seq
MIRT2257052	hsa-miR-223	CLIP-seq
MIRT2257053	hsa-miR-25	CLIP-seq
MIRT2257054	hsa-miR-27a	CLIP-seq
MIRT2257055	hsa-miR-27b	CLIP-seq
MIRT1096332	hsa-miR-300	CLIP-seq
MIRT1096333	hsa-miR-3122	CLIP-seq
MIRT2257056	hsa-miR-3137	CLIP-seq
MIRT1096335	hsa-miR-3166	CLIP-seq
MIRT2257057	hsa-miR-32	CLIP-seq
MIRT2257058	hsa-miR-323b-3p	CLIP-seq
MIRT2257059	hsa-miR-326	CLIP-seq
MIRT2257060	hsa-miR-330-5p	CLIP-seq
MIRT1096336	hsa-miR-338-5p	CLIP-seq
MIRT2257061	hsa-miR-342-3p	CLIP-seq
MIRT2257062	hsa-miR-342-5p	CLIP-seq
MIRT2257063	hsa-miR-363	CLIP-seq
MIRT2257064	hsa-miR-367	CLIP-seq
MIRT1096338	hsa-miR-3689a-3p	CLIP-seq
MIRT1096339	hsa-miR-3689c	CLIP-seq
MIRT1096340	hsa-miR-381	CLIP-seq
MIRT2257065	hsa-miR-3910	CLIP-seq
MIRT1096341	hsa-miR-3913-5p	CLIP-seq
MIRT2257066	hsa-miR-4419a	CLIP-seq
MIRT2257067	hsa-miR-4457	CLIP-seq
MIRT2257068	hsa-miR-4483	CLIP-seq
MIRT2257069	hsa-miR-4492	CLIP-seq
MIRT2257070	hsa-miR-4498	CLIP-seq
MIRT2257071	hsa-miR-4505	CLIP-seq
MIRT2257072	hsa-miR-4510	CLIP-seq
MIRT1096345	hsa-miR-4645-3p	CLIP-seq
MIRT2257073	hsa-miR-4651	CLIP-seq
MIRT2257074	hsa-miR-4664-5p	CLIP-seq
MIRT1096346	hsa-miR-4666-3p	CLIP-seq
MIRT2257075	hsa-miR-4697-3p	CLIP-seq
MIRT1096347	hsa-miR-4704-3p	CLIP-seq
MIRT1096348	hsa-miR-4728-5p	CLIP-seq
MIRT2257076	hsa-miR-4731-5p	CLIP-seq
MIRT2257077	hsa-miR-4745-3p	CLIP-seq
MIRT2257078	hsa-miR-4753-5p	CLIP-seq
MIRT2257079	hsa-miR-483-5p	CLIP-seq
MIRT2257080	hsa-miR-513b	CLIP-seq
MIRT2257081	hsa-miR-608	CLIP-seq
MIRT1096350	hsa-miR-656	CLIP-seq
MIRT2257082	hsa-miR-671-3p	CLIP-seq
MIRT2257083	hsa-miR-762	CLIP-seq
MIRT2257084	hsa-miR-92a	CLIP-seq
MIRT2257085	hsa-miR-92b	CLIP-seq
MIRT2257086	hsa-miR-938	CLIP-seq
MIRT2257087	hsa-miR-944	CLIP-seq
MIRT2257046	hsa-miR-1229	CLIP-seq
MIRT2257061	hsa-miR-342-3p	CLIP-seq
MIRT2257067	hsa-miR-4457	CLIP-seq
MIRT1096347	hsa-miR-4704-3p	CLIP-seq
MIRT2257080	hsa-miR-513b	CLIP-seq
MIRT2389923	hsa-miR-548ac	CLIP-seq
MIRT2389924	hsa-miR-548d-3p	CLIP-seq
MIRT2389925	hsa-miR-548z	CLIP-seq
MIRT1096346	hsa-miR-4666-3p	CLIP-seq
MIRT1096346	hsa-miR-4666-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
FOXO1	Unknown	23002242
HNRNPD	Unknown	15835916
NANOG	Activation	22378194
TP53	Repression	23202365

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	26299712
GO:0000785	Component	Chromatin	IEA
GO:0000785	Component	Chromatin	IMP	22327366
GO:0000785	Component	Chromatin	ISA
GO:0000902	Process	Cell morphogenesis	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IMP	22327366
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001701	Process	In utero embryonic development	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	IMP	22327366
GO:0003700	Function	DNA-binding transcription factor activity	IDA	21063504
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	16617118, 21382345
GO:0005634	Component	Nucleus	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0032715	Process	Negative regulation of interleukin-6 production	IEA
GO:0034101	Process	Erythrocyte homeostasis	IEA
GO:0034616	Process	Response to laminar fluid shear stress	IEA
GO:0035264	Process	Multicellular organism growth	IEA
GO:0040029	Process	Epigenetic regulation of gene expression	IEA
GO:0042311	Process	Vasodilation	IMP	21768538
GO:0043249	Process	Erythrocyte maturation	IEA
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IDA	21768538
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	21063504
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IGI	20551324
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	22327366, 23043106
GO:0046872	Function	Metal ion binding	IEA
GO:0048386	Process	Positive regulation of retinoic acid receptor signaling pathway	IDA	26416422
GO:0051247	Process	Positive regulation of protein metabolic process	IGI	20551324
GO:0060509	Process	Type I pneumocyte differentiation	IEA
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0071347	Process	Cellular response to interleukin-1	IEA
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0071498	Process	Cellular response to fluid shear stress	IMP	22327366
GO:0071499	Process	Cellular response to laminar fluid shear stress	IMP	23043106
GO:0097533	Process	Cellular stress response to acid chemical	IMP	26299712
GO:1903671	Process	Negative regulation of sprouting angiogenesis	IMP	26299712
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990859	Process	Cellular response to endothelin	IEA

Other IDs

• MIM: 602016
• HGNC: 6347
• e!Ensembl: ENSG00000127528

Protein

• UniProt ID: Q9Y5W3
• Protein name: Krueppel-like factor 2 (Lung krueppel-like factor)
• Protein function: Transcription factor that binds to the CACCC box in the promoter of target genes such as HBB/beta globin or NOV and activates their transcription (PubMed:21063504). Might be involved in transcriptional regulation by modulating the binding of the
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00096	zf-C2H2	272 → 296	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	302 → 326	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	332 → 354	Zinc finger, C2H2 type	Domain

• Sequence:

  MALSEPILPSFSTFASPCRERGLQERWPRAEPESGGTDDDLNSVLDFILSMGLDGLGAEA
  APEPPPPPPPPAFYYPEPGAPPPYSAPAGGLVSELLRPELDAPLGPALHGRFLLAPPGRL
  VKAEPPEADGGGGYGCAPGLTRGPRGLKREGAPGPAASCMRGPGGRPPPPPDTPPLSPDG
  PARLPAPGPRASFPPPFGGPGFGAPGPGLHYAPPAPPAFGLFDDAAAAAAALGLAPPAAR
  GLLTPPASPLELLEAKPKRGRRSWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEK
  PYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALHMKRHM

• Sequence length: 355

Pathways

KEGG:

FoxO signaling pathway
Apelin signaling pathway
Fluid shear stress and atherosclerosis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inherited Immunodeficiency Diseases	Likely pathogenic, low penetrance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY ARTERIAL HYPERTENSION	—	ClinGen, Disgenet ClinGen, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Cerebrovascular Accidents	Stroke	BEFREE	30954486		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	24107715		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	31713921		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	16945356, 20042720, 26372274, 26717516, 27837103, 28751752, 29191808, 29465752, 30881601, 31222221, 31318658, 31791197		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	30506878, 31426355		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	16945356, 20042720, 26372274, 26717516, 27837103, 28751752, 29191808, 29465752, 30881601, 31222221, 31318658, 31791197		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	17244683, 26372274, 30881601	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	27791035		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	36466816	Associate	★☆☆☆☆ Found in Text Mining only
Autonomic nervous system disorders	Autonomic Central Nervous System Diseases	BEFREE	29023738		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	25428260, 31713921		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	30429507		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26416422, 31378902		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20132413, 31378902, 36100919, 39796183	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	37147883	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26336870, 34564989, 36177006, 37386390	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32318691	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21382345		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	26449825	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35285410	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31389610		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	20440076, 29191808, 29301761, 30355159, 31521728		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	30429326	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	31679265		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	23335794		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	18218994		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	22574900, 25500203		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	32908909	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29164576, 30833076		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28112720, 28628187, 28938648, 29734178, 30092404		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	30510241		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	30510241		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32277632	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37147883	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	36466816	Associate	★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	29897969		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29023738		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	16617118, 26195219		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	16617118, 26195219, 30429326		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	LHGDN	16617118		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	30429326	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Disease	Coronary artery disease	Pubtator	22937032	Inhibit	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	31750260	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	16617118, 26195219, 31750260		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	39346917	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	18218994		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	LHGDN	18218994		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	18218994	Inhibit	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28873368, 31827706		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	23002242		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	23002242, 29660330		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17688680		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	25185079, 30298668		★☆☆☆☆ Found in Text Mining only
Dysautonomia	Dysautonomia	BEFREE	29023738		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	34224334, 37610103	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	36532015	Associate	★☆☆☆☆ Found in Text Mining only
Epiphyseal dysplasia multiple 1	Epiphyseal dysplasia	Pubtator	28873368	Inhibit	★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	25500203, 28348240		★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	32127011	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30042166		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30042166	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	38278877	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	18814951	Associate	★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	27121112, 28297625, 28892161		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	32727917	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29023738		★☆☆☆☆ Found in Text Mining only
Hematoma	Hematoma	Pubtator	32848367	Inhibit	★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	37795100	Inhibit	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	39796183	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	27837103		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	25185079, 31791197		★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	26299712		★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	Pubtator	26299712	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	35687490	Associate	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	16617118		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	26718427, 28681739, 29312497		★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformations	Intracranial arteriovenous malformation	Pubtator	29897969	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	23335794, 30429326, 30954486		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	30298668		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	37795100	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	24289128		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	19671192		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25966845, 26336870, 26853883, 27391317, 30719823		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	22574900, 25500203		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	CTD_human_DG	21053160		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	38373841, 39702240	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25501704	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	27197189		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	35687490	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	27121112		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26416422, 31378902		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21382345		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	19671192		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	31389610		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	27644252		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30520325, 30609158		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25728677, 27655487, 28381185, 29282356, 31497207		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21145737, 21892211, 25501704		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	29164576, 30833076		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	21892211		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	27121112		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	35695893	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	26728187		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	Pubtator	26728187, 34635968	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	GWASCAT_DG	30213928		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocarditis	Myocarditis	BEFREE	20440076		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26416422, 27644252, 27655487, 28381185, 28469808, 28628187, 29164576, 29245984, 30106140, 30367681, 30520325, 30531840, 30833076, 31497207, 31571902		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	19495417	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	37269647	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28130053		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15540987, 25501704, 25504755, 26840083, 27501756, 28469808, 30531840, 31646568		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	16542423		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	28873368	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Hip	Osteoarthritis	Pubtator	29944724	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	32685450	Associate	★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	31821872		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29608878, 31396323		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	31389610		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31389610	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	27644252		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	26449825	Inhibit	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	27644252	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	37269647	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	36045361	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	36343116, 38629639	Associate	★☆☆☆☆ Found in Text Mining only
Portal Hypertension	Portal Hypertension	BEFREE	25500203		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	30520325, 30609158		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	30520325	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	35346192, 36466816	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	18218994	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29079188		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	26416422		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	27855271		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	26416422, 30506878, 31426355		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	23499374, 31002870		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	34741382	Associate	★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	24107715		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25728677, 27655487, 28381185, 29282356, 31497207		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28214253, 32016968, 34076999	Associate	★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	23507969		★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	36343116	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	16341264, 22937032, 36343116, 40362576	Associate	★☆☆☆☆ Found in Text Mining only
Thrombotic Microangiopathies	Thrombotic Microangiopathies	BEFREE	23635876		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	30106140		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	30106140, 40415364	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	30070340		★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	Pubtator	37795100	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	29678899	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25119587	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	LHGDN	16043642		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	33946046, 34253708	Associate	★☆☆☆☆ Found in Text Mining only