Gene Gene information from NCBI Gene database.
Entrez ID 10360
Gene name Nucleophosmin/nucleoplasmin 3
Gene symbol NPM3
Synonyms (NCBI Gene)
PORMINTMEM123
Chromosome 10
Chromosome location 10q24.32
Summary The protein encoded by this gene is related to the nuclear chaperone phosphoproteins, nucleoplasmin and nucleophosmin. This protein is strongly expressed in diverse cell types where it localizes primarily to the nucleus. Based on its similarity to nucleop
miRNA miRNA information provided by mirtarbase database.
815
miRTarBase ID miRNA Experiments Reference
MIRT022521 hsa-miR-124-3p Proteomics;Microarray 18668037
MIRT048670 hsa-miR-99a-5p CLASH 23622248
MIRT553570 hsa-miR-548ac HITS-CLIP 21572407
MIRT553569 hsa-miR-548bb-3p HITS-CLIP 21572407
MIRT553568 hsa-miR-548d-3p HITS-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
GO ID Ontology Definition Evidence Reference
GO:0003682 Function Chromatin binding IBA
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0003723 Function RNA binding IBA
GO:0005515 Function Protein binding IPI 22190034, 25416956, 28514442, 31515488, 32296183, 33961781
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606456 7931 ENSG00000107833
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O75607
Protein name Nucleoplasmin-3
Protein function Plays a role in the regulation of diverse cellular processes such as ribosome biogenesis, chromatin remodeling or protein chaperoning (PubMed:20073534, PubMed:22362753). Modulates the histone chaperone function and the RNA-binding activity of nu
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03066 Nucleoplasmin 38 139 Nucleoplasmin/nucleophosmin domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11722795}.
Sequence
MAAGTAAALAFLSQESRTRAGGVGGLRVPAPVTMDSFFFGCELSGHTRSFTFKVEEEDDA
EHVLALTMLCLTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPV
TFRLKSGSGPVRITGRHQI
VTMSNDVSEEESEEEEEDSDEEEVELCPILPAKKQGGRP
Sequence length 178
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ATTENTION DEFICIT HYPERACTIVITY DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma of lung (disorder) Lung adenocarcinoma CTD_human_DG 27602772
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Alzheimer disease Pubtator 26512942 Associate
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 39300184 Associate
★☆☆☆☆
Found in Text Mining only
Diffuse Large B-Cell Lymphoma Diffuse Lymphoma BEFREE 17255358
★☆☆☆☆
Found in Text Mining only
Insomnia Fatal Familial Insomnia Pubtator 27338255 Associate
★☆☆☆☆
Found in Text Mining only
Lymphoma Follicular Lymphoma Pubtator 17255358 Associate
★☆☆☆☆
Found in Text Mining only
Neoplasms Neoplasms BEFREE 20428766, 23131872
★☆☆☆☆
Found in Text Mining only
Parkinson Disease Parkinson disease BEFREE 26621506
★☆☆☆☆
Found in Text Mining only
Parkinson Disease Parkinson disease Pubtator 26621506 Associate
★☆☆☆☆
Found in Text Mining only
Prostatic Neoplasms Prostatic neoplasm Pubtator 37870957 Associate
★☆☆☆☆
Found in Text Mining only