Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10352
Gene name	Tryptophanyl tRNA synthetase 2, mitochondrial
Gene symbol	WARS2
Synonyms (NCBI Gene)	NEMMLASPKDYS3TrpRSmtTrpRS
Chromosome	1
Chromosome location	1p12
Summary	Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first prot

Show/Hide all (9)

SNP ID	Visualize variation	Clinical significance	Consequence
rs139194636	T>C	Likely-pathogenic	Missense variant, 3 prime UTR variant, coding sequence variant
rs145867327	T>A	Pathogenic, uncertain-significance	Coding sequence variant, 3 prime UTR variant, missense variant
rs746478253	G>-	Uncertain-significance, pathogenic	3 prime UTR variant, coding sequence variant, frameshift variant
rs757600616	G>A	Likely-pathogenic	3 prime UTR variant, coding sequence variant, stop gained
rs772867219	GAA>-	Uncertain-significance, pathogenic	Intron variant, inframe deletion, coding sequence variant
rs912133959	C>G,T	Pathogenic	Missense variant, coding sequence variant
rs1253426801	T>-,TT	Pathogenic	Frameshift variant, coding sequence variant, intron variant
rs1553241795	C>A	Pathogenic	Intron variant, missense variant, coding sequence variant, 5 prime UTR variant
rs1571323203	C>T	Likely-pathogenic	Coding sequence variant, 5 prime UTR variant, intron variant, missense variant

Show/Hide all (99)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027840	hsa-miR-98-5p	Microarray	19088304
MIRT032492	hsa-let-7b-5p	Proteomics	18668040
MIRT550795	hsa-miR-551b-5p	PAR-CLIP	21572407
MIRT265715	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT550794	hsa-miR-646	PAR-CLIP	21572407
MIRT550793	hsa-miR-656-3p	PAR-CLIP	21572407
MIRT550792	hsa-miR-4742-5p	PAR-CLIP	21572407
MIRT550790	hsa-miR-4269	PAR-CLIP	21572407
MIRT550791	hsa-miR-6715b-5p	PAR-CLIP	21572407
MIRT550789	hsa-miR-4514	PAR-CLIP	21572407
MIRT550788	hsa-miR-4692	PAR-CLIP	21572407
MIRT550787	hsa-miR-570-3p	PAR-CLIP	21572407
MIRT550786	hsa-miR-6792-5p	PAR-CLIP	21572407
MIRT265716	hsa-miR-4503	PAR-CLIP	21572407
MIRT550795	hsa-miR-551b-5p	PAR-CLIP	21572407
MIRT265715	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT550794	hsa-miR-646	PAR-CLIP	21572407
MIRT550793	hsa-miR-656-3p	PAR-CLIP	21572407
MIRT550792	hsa-miR-4742-5p	PAR-CLIP	21572407
MIRT550790	hsa-miR-4269	PAR-CLIP	21572407
MIRT550791	hsa-miR-6715b-5p	PAR-CLIP	21572407
MIRT550789	hsa-miR-4514	PAR-CLIP	21572407
MIRT550788	hsa-miR-4692	PAR-CLIP	21572407
MIRT550787	hsa-miR-570-3p	PAR-CLIP	21572407
MIRT550786	hsa-miR-6792-5p	PAR-CLIP	21572407
MIRT265716	hsa-miR-4503	PAR-CLIP	21572407
MIRT1488514	hsa-miR-1224-3p	CLIP-seq
MIRT1488515	hsa-miR-145	CLIP-seq
MIRT1488516	hsa-miR-219-2-3p	CLIP-seq
MIRT1488517	hsa-miR-2964a-3p	CLIP-seq
MIRT1488518	hsa-miR-298	CLIP-seq
MIRT1488519	hsa-miR-3117-3p	CLIP-seq
MIRT1488520	hsa-miR-3143	CLIP-seq
MIRT1488521	hsa-miR-3148	CLIP-seq
MIRT1488522	hsa-miR-3163	CLIP-seq
MIRT1488523	hsa-miR-3169	CLIP-seq
MIRT1488524	hsa-miR-3660	CLIP-seq
MIRT1488525	hsa-miR-3682-3p	CLIP-seq
MIRT1488526	hsa-miR-3978	CLIP-seq
MIRT1488527	hsa-miR-4256	CLIP-seq
MIRT1488528	hsa-miR-432	CLIP-seq
MIRT1488529	hsa-miR-4457	CLIP-seq
MIRT1488530	hsa-miR-4526	CLIP-seq
MIRT1488531	hsa-miR-4680-3p	CLIP-seq
MIRT1488532	hsa-miR-4694-3p	CLIP-seq
MIRT1488533	hsa-miR-4698	CLIP-seq
MIRT1488534	hsa-miR-4731-3p	CLIP-seq
MIRT1488535	hsa-miR-4759	CLIP-seq
MIRT1488536	hsa-miR-4801	CLIP-seq
MIRT1488537	hsa-miR-519a	CLIP-seq
MIRT1488538	hsa-miR-519b-3p	CLIP-seq
MIRT1488539	hsa-miR-519c-3p	CLIP-seq
MIRT1488540	hsa-miR-570	CLIP-seq
MIRT1488541	hsa-miR-600	CLIP-seq
MIRT1488542	hsa-miR-642b	CLIP-seq
MIRT1488543	hsa-miR-1184	CLIP-seq
MIRT1488544	hsa-miR-1205	CLIP-seq
MIRT1488545	hsa-miR-136	CLIP-seq
MIRT1488546	hsa-miR-1972	CLIP-seq
MIRT1488547	hsa-miR-23a	CLIP-seq
MIRT1488548	hsa-miR-23b	CLIP-seq
MIRT1488549	hsa-miR-23c	CLIP-seq
MIRT1488550	hsa-miR-3145-5p	CLIP-seq
MIRT1488551	hsa-miR-3158-5p	CLIP-seq
MIRT1488552	hsa-miR-3682-5p	CLIP-seq
MIRT1488553	hsa-miR-4705	CLIP-seq
MIRT1488554	hsa-miR-4719	CLIP-seq
MIRT1488555	hsa-miR-508-5p	CLIP-seq
MIRT1488556	hsa-miR-544	CLIP-seq
MIRT2147128	hsa-miR-122	CLIP-seq
MIRT2147129	hsa-miR-1248	CLIP-seq
MIRT2147130	hsa-miR-1324	CLIP-seq
MIRT2147131	hsa-miR-141	CLIP-seq
MIRT2147132	hsa-miR-200a	CLIP-seq
MIRT2147133	hsa-miR-4297	CLIP-seq
MIRT2147134	hsa-miR-4633-5p	CLIP-seq
MIRT2147135	hsa-miR-526b	CLIP-seq
MIRT2147136	hsa-miR-532-5p	CLIP-seq
MIRT2147137	hsa-miR-550a	CLIP-seq
MIRT2147138	hsa-miR-574-5p	CLIP-seq
MIRT2147139	hsa-miR-648	CLIP-seq
MIRT2147140	hsa-miR-1258	CLIP-seq
MIRT2147141	hsa-miR-3159	CLIP-seq
MIRT2147142	hsa-miR-651	CLIP-seq
MIRT2367629	hsa-miR-101	CLIP-seq
MIRT2367630	hsa-miR-144	CLIP-seq
MIRT1488550	hsa-miR-3145-5p	CLIP-seq
MIRT2367631	hsa-miR-3653	CLIP-seq
MIRT2367632	hsa-miR-3658	CLIP-seq
MIRT1488535	hsa-miR-4759	CLIP-seq
MIRT1488555	hsa-miR-508-5p	CLIP-seq
MIRT2367633	hsa-miR-520a-5p	CLIP-seq
MIRT2367634	hsa-miR-525-5p	CLIP-seq
MIRT2367635	hsa-miR-582-5p	CLIP-seq
MIRT2367631	hsa-miR-3653	CLIP-seq
MIRT2367632	hsa-miR-3658	CLIP-seq
MIRT2396905	hsa-miR-4477a	CLIP-seq
MIRT1488533	hsa-miR-4698	CLIP-seq
MIRT2661100	hsa-miR-548an	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001570	Process	Vasculogenesis	IEA
GO:0004812	Function	Aminoacyl-tRNA ligase activity	IEA
GO:0004830	Function	Tryptophan-tRNA ligase activity	IBA
GO:0004830	Function	Tryptophan-tRNA ligase activity	IDA	10828066
GO:0004830	Function	Tryptophan-tRNA ligase activity	IEA
GO:0004830	Function	Tryptophan-tRNA ligase activity	TAS
GO:0005524	Function	ATP binding	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	10828066
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	IBA
GO:0005759	Component	Mitochondrial matrix	IDA	28236339
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0006412	Process	Translation	IEA
GO:0006418	Process	TRNA aminoacylation for protein translation	IEA
GO:0006418	Process	TRNA aminoacylation for protein translation	TAS
GO:0006436	Process	Tryptophanyl-tRNA aminoacylation	IEA
GO:0016874	Function	Ligase activity	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0070183	Process	Mitochondrial tryptophanyl-tRNA aminoacylation	IBA

MIM	HGNC	e!Ensembl
604733	12730	ENSG00000116874

Q9UGM6

Protein name

Tryptophan--tRNA ligase, mitochondrial (EC 6.1.1.2) ((Mt)TrpRS) (Tryptophanyl-tRNA synthetase) (TrpRS)

Protein function

Catalyzes the attachment of tryptophan to tRNA(Trp) in a two-step reaction: tryptophan is first activated by ATP to form Trp-AMP and then transferred to the acceptor end of tRNA(Trp).

PDB

5EKD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00579	tRNA-synt_1b	30 → 315	tRNA synthetases class I (W and Y)	Family

Tissue specificity

TISSUE SPECIFICITY: Brain. {ECO:0000269|PubMed:28236339}.

Sequence

MALHSMRKARERWSFIRALHKGSAAAPALQKDSKKRVFSGIQPTGILHLGNYLGAIESWV
RLQDEYDSVLYSIVDLHSITVPQDPAVLRQSILDMTAVLLACGINPEKSILFQQSQVSEH
TQLSWILSCMVRLPRLQHLHQWKAKTTKQKHDGTVGLLTYPVLQAADILLYKSTHVPVGE
DQVQHMELVQDLAQGFNKKYGEFFPVPESILTSMKKVKSLRDPSAKMSKSDPDKLATVRI
TDSPEEIVQKFRKAVTDFTSEVTYDPAGRAGVSNIVAVHAAVTGLSVEEVVRRSAGMNTA
RYKLAVADAVIEKFAPIKREIEKLKLDKDHLEKVLQIGSAKAKELAYTVCQEVKKLVGFL

Sequence length

360

Interactions

View interactions

	KEGG		Reactome
	Aminoacyl-tRNA biosynthesis		Mitochondrial tRNA aminoacylation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Neurodevelopmental disorder, mitochondrial, with abnormal movements and lactic acidosis, with or without seizures	Likely pathogenic; Pathogenic	rs765904496, rs2101095108, rs745543661, rs757600616, rs145867327, rs1553241795, rs912133959, rs1571323203, rs137890886	RCV001837432 RCV002249200 RCV002249201 RCV001801509 RCV000509075 View all (4 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Parkinsonism-dystonia 3, childhood-onset	Likely pathogenic; Pathogenic	rs11552864, rs1648733523, rs1571323203, rs137890886	RCV002253067 RCV002289073 RCV001836927 RCV001836976	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
WARS2-related disorder	Likely pathogenic; Pathogenic	rs757600616, rs145867327	RCV004739603 RCV003323579	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mitochondrial disease	Uncertain significance	ClinVar ClinGen, Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
MITOCHONDRIAL DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental disorder	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSTRUCTIVE SLEEP APNEA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SIALOLITHIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WARS2-RELATED COMBINED OXIDATIVE PHOSPHORYLATION DEFECT	—	Disgenet, Orphanet Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (66)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Absence of septum pellucidum	Absence Of Septum Pellucidum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	GWASCAT_DG	28196072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic behavior	Autism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24098497	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36685508	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Central visual impairment	Central Visual Impairment	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar atrophy	Cerebellar atrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Clumsiness - motor delay	Motor delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cortical Dysplasia	Cortical Dysplasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31520154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	31834547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	31282308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyssomnias	Dyssomnia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Exotropia	Exotropia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid receptor deficiency/resistance	Pubtator	30026463	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	19363598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoplasia of corpus callosum	Hypoplasia Of Corpus Callosum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	28236339, 28650581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	29120065	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukoencephalopathy	Leukoencephalopathy	BEFREE	28650581, 29120065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21926542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	19363598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild Mental Retardation	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial Diseases	BEFREE	28905505		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mitochondrial encephalopathy	Mitochondrial encephalopathy	BEFREE	28905505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Moderate intellectual disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Moderate intellectual disability	Mental retardation	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	15939065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21926542, 26110569, 7814143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	16616781		★★★★★ ★☆☆☆☆ Found in Text Mining only
NEURODEVELOPMENTAL DISORDER, MITOCHONDRIAL, WITH ABNORMAL MOVEMENTS AND LACTIC ACIDOSIS, WITH OR WITHOUT SEIZURES	Neurodevelopmental Disorder, Mitochondrial, With Abnormal Movements And Lactic Acidosis, With Or Without Seizures	GENOMICS_ENGLAND_DG	28236339, 28905505		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
NEURODEVELOPMENTAL DISORDER, MITOCHONDRIAL, WITH ABNORMAL MOVEMENTS AND LACTIC ACIDOSIS, WITH OR WITHOUT SEIZURES	Neurodevelopmental Disorder, Mitochondrial, With Abnormal Movements And Lactic Acidosis, With Or Without Seizures	UNIPROT_DG	28236339, 28650581, 28905505		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
NEURODEVELOPMENTAL DISORDER, MITOCHONDRIAL, WITH ABNORMAL MOVEMENTS AND LACTIC ACIDOSIS, WITH OR WITHOUT SEIZURES	Neurodevelopmental Disorder, Mitochondrial, With Abnormal Movements And Lactic Acidosis, With Or Without Seizures	BEFREE	31282308		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
NEURODEVELOPMENTAL DISORDER, MITOCHONDRIAL, WITH ABNORMAL MOVEMENTS AND LACTIC ACIDOSIS, WITH OR WITHOUT SEIZURES	Neurodevelopmental Disorder, Mitochondrial, With Abnormal Movements And Lactic Acidosis, With Or Without Seizures	CLINVAR_DG			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	31282308		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuropathy	Neuropathy	BEFREE	28369220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	31975641	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic Atrophy	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic Atrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	31975641	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21926542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease Secondary	Secondary parkinson disease	Pubtator	29120065	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	29120065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral motor neuropathy	Motor nerve neuritis	BEFREE	28369220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymicrogyria	Polymicrogyria	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	24515434, 30714436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Salaam Seizures	Salaam Seizures	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe intellectual disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic Quadriplegia	Spastic Quadriplegia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxias	Spinocerebellar ataxia	Pubtator	29783990	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stereotyped Behavior	Stereotyped Behavior	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	26209610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	26209610	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	31694485		★★★★★ ★☆☆☆☆ Found in Text Mining only
WARS2-related combined oxidative phosphorylation defect	Combined Oxidative Phosphorylation Deficiency	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

WARS2 (tryptophanyl tRNA synthetase 2, mitochondrial)