Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10342
Gene name	Trafficking from ER to golgi regulator
Gene symbol	TFG
Synonyms (NCBI Gene)	HMSNPSPG57TF6TRKT3
Chromosome	3
Chromosome location	3q12.2
Summary	There are several documented fusion oncoproteins encoded partially by this gene. This gene also participates in several oncogenic rearrangements resulting in anaplastic lymphoma and mixoid chondrosarcoma, and may play a role in the NF-kappaB pathway. Mult

Show/Hide all (6)

SNP ID	Visualize variation	Clinical significance	Consequence
rs111356679	C>G	Conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs207482230	C>T	Pathogenic	Coding sequence variant, missense variant
rs587777175	C>T	Pathogenic	Missense variant, coding sequence variant
rs587777789	G>A,T	Pathogenic	Missense variant, coding sequence variant
rs764959531	C>A,T	Likely-pathogenic	Coding sequence variant, synonymous variant, stop gained
rs1559726842	T>C	Uncertain-significance, likely-pathogenic	Missense variant, coding sequence variant

106

Show/Hide all (106)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004131	hsa-miR-192-5p	Microarray	16822819
MIRT049807	hsa-miR-92a-3p	CLASH	23622248
MIRT048315	hsa-miR-106a-5p	CLASH	23622248
MIRT041287	hsa-miR-193b-3p	CLASH	23622248
MIRT036854	hsa-miR-877-3p	CLASH	23622248
MIRT160565	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT160565	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT1420604	hsa-miR-2053	CLIP-seq
MIRT1420605	hsa-miR-338-3p	CLIP-seq
MIRT1420606	hsa-miR-3591-3p	CLIP-seq
MIRT1420607	hsa-miR-371-5p	CLIP-seq
MIRT1420608	hsa-miR-371b-5p	CLIP-seq
MIRT1420609	hsa-miR-4275	CLIP-seq
MIRT1420610	hsa-miR-4530	CLIP-seq
MIRT1420611	hsa-miR-487a	CLIP-seq
MIRT1420612	hsa-miR-499-3p	CLIP-seq
MIRT1420613	hsa-miR-499a-3p	CLIP-seq
MIRT1420614	hsa-miR-513c	CLIP-seq
MIRT1420615	hsa-miR-514b-5p	CLIP-seq
MIRT1420616	hsa-miR-545	CLIP-seq
MIRT1420617	hsa-miR-569	CLIP-seq
MIRT1420618	hsa-miR-630	CLIP-seq
MIRT1420619	hsa-miR-643	CLIP-seq
MIRT1420620	hsa-miR-889	CLIP-seq
MIRT1420621	hsa-miR-15a	CLIP-seq
MIRT1420622	hsa-miR-15b	CLIP-seq
MIRT1420623	hsa-miR-16	CLIP-seq
MIRT1420624	hsa-miR-195	CLIP-seq
MIRT1420604	hsa-miR-2053	CLIP-seq
MIRT1420625	hsa-miR-221	CLIP-seq
MIRT1420626	hsa-miR-222	CLIP-seq
MIRT1420627	hsa-miR-3122	CLIP-seq
MIRT1420628	hsa-miR-323-3p	CLIP-seq
MIRT1420629	hsa-miR-3689a-3p	CLIP-seq
MIRT1420630	hsa-miR-3689c	CLIP-seq
MIRT1420607	hsa-miR-371-5p	CLIP-seq
MIRT1420608	hsa-miR-371b-5p	CLIP-seq
MIRT1420631	hsa-miR-3913-5p	CLIP-seq
MIRT1420632	hsa-miR-424	CLIP-seq
MIRT1420633	hsa-miR-4302	CLIP-seq
MIRT1420634	hsa-miR-4426	CLIP-seq
MIRT1420635	hsa-miR-4477a	CLIP-seq
MIRT1420636	hsa-miR-4480	CLIP-seq
MIRT1420637	hsa-miR-4524	CLIP-seq
MIRT1420638	hsa-miR-4647	CLIP-seq
MIRT1420639	hsa-miR-4662b	CLIP-seq
MIRT1420640	hsa-miR-4728-5p	CLIP-seq
MIRT1420641	hsa-miR-4789-5p	CLIP-seq
MIRT1420642	hsa-miR-497	CLIP-seq
MIRT1420612	hsa-miR-499-3p	CLIP-seq
MIRT1420613	hsa-miR-499a-3p	CLIP-seq
MIRT1420643	hsa-miR-503	CLIP-seq
MIRT1420614	hsa-miR-513c	CLIP-seq
MIRT1420615	hsa-miR-514b-5p	CLIP-seq
MIRT1420617	hsa-miR-569	CLIP-seq
MIRT1420644	hsa-miR-621	CLIP-seq
MIRT1420618	hsa-miR-630	CLIP-seq
MIRT1420645	hsa-miR-633	CLIP-seq
MIRT1420619	hsa-miR-643	CLIP-seq
MIRT1420646	hsa-miR-646	CLIP-seq
MIRT1420620	hsa-miR-889	CLIP-seq
MIRT1420633	hsa-miR-4302	CLIP-seq
MIRT1420635	hsa-miR-4477a	CLIP-seq
MIRT1420641	hsa-miR-4789-5p	CLIP-seq
MIRT1420618	hsa-miR-630	CLIP-seq
MIRT1420619	hsa-miR-643	CLIP-seq
MIRT1420620	hsa-miR-889	CLIP-seq
MIRT2126327	hsa-miR-4705	CLIP-seq
MIRT1420620	hsa-miR-889	CLIP-seq
MIRT2126328	hsa-miR-34b	CLIP-seq
MIRT1420607	hsa-miR-371-5p	CLIP-seq
MIRT1420608	hsa-miR-371b-5p	CLIP-seq
MIRT1420633	hsa-miR-4302	CLIP-seq
MIRT2126329	hsa-miR-4666-5p	CLIP-seq
MIRT2126327	hsa-miR-4705	CLIP-seq
MIRT1420641	hsa-miR-4789-5p	CLIP-seq
MIRT1420614	hsa-miR-513c	CLIP-seq
MIRT1420615	hsa-miR-514b-5p	CLIP-seq
MIRT1420618	hsa-miR-630	CLIP-seq
MIRT1420619	hsa-miR-643	CLIP-seq
MIRT1420620	hsa-miR-889	CLIP-seq
MIRT2348317	hsa-miR-1243	CLIP-seq
MIRT2348318	hsa-miR-1278	CLIP-seq
MIRT2348319	hsa-miR-1289	CLIP-seq
MIRT1420627	hsa-miR-3122	CLIP-seq
MIRT2348320	hsa-miR-3198	CLIP-seq
MIRT1420605	hsa-miR-338-3p	CLIP-seq
MIRT2126328	hsa-miR-34b	CLIP-seq
MIRT1420606	hsa-miR-3591-3p	CLIP-seq
MIRT2348321	hsa-miR-3654	CLIP-seq
MIRT1420629	hsa-miR-3689a-3p	CLIP-seq
MIRT1420630	hsa-miR-3689c	CLIP-seq
MIRT1420631	hsa-miR-3913-5p	CLIP-seq
MIRT2348322	hsa-miR-4255	CLIP-seq
MIRT2348323	hsa-miR-4294	CLIP-seq
MIRT1420633	hsa-miR-4302	CLIP-seq
MIRT2348324	hsa-miR-4309	CLIP-seq
MIRT1420635	hsa-miR-4477a	CLIP-seq
MIRT1420610	hsa-miR-4530	CLIP-seq
MIRT2126329	hsa-miR-4666-5p	CLIP-seq
MIRT2126327	hsa-miR-4705	CLIP-seq
MIRT1420640	hsa-miR-4728-5p	CLIP-seq
MIRT1420641	hsa-miR-4789-5p	CLIP-seq
MIRT1420616	hsa-miR-545	CLIP-seq
MIRT1420620	hsa-miR-889	CLIP-seq
MIRT2348325	hsa-miR-924	CLIP-seq

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 17110338, 21478858, 25416956, 25910212, 26871637, 27813252, 31515488, 32296183, 32814053, 35156780, 36012204
GO:0005737	Component	Cytoplasm	NAS	7565764
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	IBA
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	IEA
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	IMP	21478858, 27813252
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	16169070, 25416956, 27107012, 32296183
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	HMP	12761501
GO:0048208	Process	COPII vesicle coating	IEA
GO:0070971	Component	Endoplasmic reticulum exit site	IBA
GO:0070971	Component	Endoplasmic reticulum exit site	IDA	21478858, 27813252

MIM	HGNC	e!Ensembl
602498	11758	ENSG00000114354

Q92734

Protein name

Protein TFG (TRK-fused gene protein)

Protein function

Plays a role in the normal dynamic function of the endoplasmic reticulum (ER) and its associated microtubules (PubMed:23479643, PubMed:27813252). Required for secretory cargo traffic from the endoplasmic reticulum to the Golgi apparatus (PubMed:

PDB

8TEQ , 8TER , 9E7C

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00564	PB1	10 → 93	PB1 domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous.

Sequence

MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKD
EDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLL
DSLEPPGEPGPSTNIPENDTVDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKN
VMSAFGLTDDQVSGPPSAPAEDRSGTPDSIASSSSAAHPPGVQPQQPPYTGAQTQAGQIE
GQMYQQYQQQAGYGAQQPQAPPQQPQQYGIQYSASYSQQTGPQQPQQFQGYGQQPTSQAP
APAFSGQPQQLPAQPPQQYQASNYPAQTYTAQTSQPTNYTVAPASQPGMAPSQPGAYQPR
PGFTSLPGSTMTPPPSGPNPYARNRPPFGQGYTQPGPGYR

Sequence length

400

Interactions

View interactions

	KEGG		Reactome
	Pathways in cancer Thyroid cancer		COPII-mediated vesicle transport

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Amyotrophic Lateral Sclerosis with Sensory Neuropathy	Likely pathogenic; Pathogenic	rs207482230	RCV001095428	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hereditary motor and sensory neuropathy, Okinawa type	Pathogenic; Likely pathogenic	rs587777175, rs989357227, rs587777789, rs207482230	RCV001038327 RCV002000010 RCV000144505 RCV000030736	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hereditary spastic paraplegia 57	Pathogenic; Likely pathogenic	rs587777175, rs989357227, rs587777789, rs207482230	RCV000087273 RCV002000010 RCV004767089 RCV000642397	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (27)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL DOMINANT CHARCOT-MARIE-TOOTH DISEASE TYPE 2 DUE TO TFG MUTATION	—	Disgenet, Orphanet Disgenet, Orphanet Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL RECESSIVE SPASTIC PARAPLEGIA TYPE 57	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Charcot-Marie-Tooth disease	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Cholangiocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIFFERENTIATED THYROID CARCINOMA	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EXTRASKELETAL MYXOID CHONDROSARCOMA	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROPATHY, HEREDITARY MOTOR AND SENSORY, OKINAWA TYPE	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPASTIC PARAPLEGIA 57, AUTOSOMAL RECESSIVE	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPASTIC PARAPLEGIA, HEREDITARY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TFG-related disorder	Conflicting classifications of pathogenicity; Likely benign; Uncertain significance; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (99)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	30003432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis 2 Juvenile	Amyotrophic lateral sclerosis	Pubtator	27601211	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	18093335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal dominant Charcot-Marie-Tooth disease type 2 due to TFG mutation	Charcot-Marie-Tooth Disease	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autosomal recessive spastic paraplegia type 57	Spastic Paraplegia	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	12680217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	31754244, 32239802	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	22240197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29180379	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	32239802	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth Disease	Charcot-Marie-Tooth Disease	BEFREE	25098539, 31111683		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	31754244	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chondrosarcoma	Chondrosarcoma	LHGDN	15188455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	22581839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10456659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19863607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Complicated hereditary spastic paraplegia	Spastic paraplegia	BEFREE	30467354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	28337255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing syndrome	Pubtator	36690805	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29026155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	15957132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Differentiated thyroid carcinoma	Thyroid Carcinoma	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Distal lower limb amyotrophy	Distal lower limb amyotrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Extraskeletal Myxoid Chondrosarcoma	Extraskeletal Myxoid Chondrosarcoma	BEFREE	15188455, 28383167		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Extraskeletal Myxoid Chondrosarcoma	Extraskeletal Myxoid Chondrosarcoma	ORPHANET_DG	22581839		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Extraskeletal myxoid chondrosarcoma	Extraskeletal Myxoid Chondrosarcoma	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Extraskeletal Myxoid Chondrosarcoma	Extraskeletal Myxoid Chondrosarcoma	GENOMICS_ENGLAND_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	BEFREE	18093335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	18093335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	18093335	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	18242762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	27492651, 27601211, 28124177, 30157421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Motor and Sensory Neuropathies	Hereditary motor and sensory neuropathy	BEFREE	22883144, 23553329, 29026155, 31111683, 31449671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary motor and sensory neuropathy, Okinawa type	Hereditary Motor And Sensory Neuropathy	Orphanet			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hereditary Motor and Sensory-Neuropathy Type II	Dysautonomia	BEFREE	25098539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Sensory and Motor Neuropathy	Hereditary sensory and motor neuropathy	Pubtator	35864671	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	16828231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Myofibroblastic Tumor	Inflammatory Myofibroblastic Tumor	BEFREE	25612511, 31690781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	GENOMICS_ENGLAND_DG	27492651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	10556217, 11943732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	20164024	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	19797732		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Lymphoma	Pubtator	19797732	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Glioma	Glioma	BEFREE	10766355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12680217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21809350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28393763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19863607		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	22250051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	28449809	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	22250051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Motor neuron atrophy	Motor neuron atrophy	BEFREE	22883144, 28196470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	19797732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10766355, 20164024, 22250051, 24692687, 25315705, 26503213, 28936555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	30157421	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29026155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular Diseases	BEFREE	25725944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	GENOMICS_ENGLAND_DG	27492651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	30157421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy, hereditary motor and sensory, Okinawa type	Neuropathy	CLINVAR_DG	22883144, 23553329, 24613659, 25725944, 26257172, 28196470		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuropathy, hereditary motor and sensory, Okinawa type	Neuropathy	ORPHANET_DG	22883144		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuropathy, hereditary motor and sensory, Okinawa type	Neuropathy	UNIPROT_DG	22883144, 27813252		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuropathy, hereditary motor and sensory, Okinawa type	Neuropathy	GENOMICS_ENGLAND_DG	27492651, 28124177		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuropathy, hereditary motor and sensory, Okinawa type	Neuropathy	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	18242762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic Atrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	27532429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	20969748	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	36690805	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	19883730, 9169129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	ORPHANET_DG	9169129, 9172002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	30467354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	30467354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyneuropathy, Motor	Polyneuropathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	21809350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proximal amyotrophy	Amyotrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Quadriplegia	Quadriplegia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	28510278	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma, Spindle Cell	Sarcoma	BEFREE	28510278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensorimotor neuropathy	Sensorimotor neuropathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensory neuropathy	Sensory neuropathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	28489605	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	19797732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia	Spastic Paraplegia	BEFREE	30467354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia	Spastic Paraplegia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
SPASTIC PARAPLEGIA 57, AUTOSOMAL RECESSIVE	Spastic Paraplegia	CLINVAR_DG	22883144, 23553329, 24613659, 25725944, 28196470		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPASTIC PARAPLEGIA 57, AUTOSOMAL RECESSIVE	Spastic Paraplegia	ORPHANET_DG	23479643		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPASTIC PARAPLEGIA 57, AUTOSOMAL RECESSIVE	Spastic Paraplegia	UNIPROT_DG	23479643, 27492651, 27813252, 30237576		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPASTIC PARAPLEGIA 57, AUTOSOMAL RECESSIVE	Spastic Paraplegia	GENOMICS_ENGLAND_DG	27492651, 28124177		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPASTIC PARAPLEGIA 57, AUTOSOMAL RECESSIVE	Spastic Paraplegia	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Spastic Paraplegia Hereditary	Hereditary spastic paraplegia	Pubtator	27601211, 30157421	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia, Hereditary	Spastic paraplegia	BEFREE	27492651, 28124177, 30157421		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	9169129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	19797732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	19797732, 32737449	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vision Disorders	Visual disorder	Pubtator	27601211	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TFG (trafficking from ER to golgi regulator)