Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	10330
Gene name	Canopy FGF signaling regulator 2
Gene symbol	CNPY2
Synonyms (NCBI Gene)	HP10390MSAPTMEM4ZSIG9
Chromosome	12
Chromosome location	12q13.3

Show/Hide all (70)

miRTarBase ID	miRNA	Experiments
MIRT901289	hsa-miR-139-5p	CLIP-seq
MIRT901290	hsa-miR-2110	CLIP-seq
MIRT901291	hsa-miR-3120-3p	CLIP-seq
MIRT901292	hsa-miR-3154	CLIP-seq
MIRT901293	hsa-miR-339-5p	CLIP-seq
MIRT901294	hsa-miR-3691-5p	CLIP-seq
MIRT901295	hsa-miR-383	CLIP-seq
MIRT901296	hsa-miR-3973	CLIP-seq
MIRT901297	hsa-miR-4271	CLIP-seq
MIRT901298	hsa-miR-4274	CLIP-seq
MIRT901299	hsa-miR-4303	CLIP-seq
MIRT901300	hsa-miR-4434	CLIP-seq
MIRT901301	hsa-miR-4436a	CLIP-seq
MIRT901302	hsa-miR-4491	CLIP-seq
MIRT901303	hsa-miR-4503	CLIP-seq
MIRT901304	hsa-miR-4516	CLIP-seq
MIRT901305	hsa-miR-4531	CLIP-seq
MIRT901306	hsa-miR-4639-5p	CLIP-seq
MIRT901307	hsa-miR-4657	CLIP-seq
MIRT901308	hsa-miR-4659a-3p	CLIP-seq
MIRT901309	hsa-miR-4659b-3p	CLIP-seq
MIRT901310	hsa-miR-4682	CLIP-seq
MIRT901311	hsa-miR-4725-3p	CLIP-seq
MIRT901312	hsa-miR-4752	CLIP-seq
MIRT901313	hsa-miR-4762-3p	CLIP-seq
MIRT901314	hsa-miR-4762-5p	CLIP-seq
MIRT901315	hsa-miR-4764-5p	CLIP-seq
MIRT901316	hsa-miR-4772-5p	CLIP-seq
MIRT901317	hsa-miR-495	CLIP-seq
MIRT901318	hsa-miR-519a	CLIP-seq
MIRT901319	hsa-miR-519b-3p	CLIP-seq
MIRT901320	hsa-miR-519c-3p	CLIP-seq
MIRT901321	hsa-miR-548l	CLIP-seq
MIRT901322	hsa-miR-596	CLIP-seq
MIRT901323	hsa-miR-627	CLIP-seq
MIRT901324	hsa-miR-922	CLIP-seq
MIRT901325	hsa-miR-924	CLIP-seq
MIRT901290	hsa-miR-2110	CLIP-seq
MIRT901297	hsa-miR-4271	CLIP-seq
MIRT901311	hsa-miR-4725-3p	CLIP-seq
MIRT901318	hsa-miR-519a	CLIP-seq
MIRT901319	hsa-miR-519b-3p	CLIP-seq
MIRT901320	hsa-miR-519c-3p	CLIP-seq
MIRT901322	hsa-miR-596	CLIP-seq
MIRT1967379	hsa-miR-1343	CLIP-seq
MIRT1967380	hsa-miR-3679-3p	CLIP-seq
MIRT1967381	hsa-miR-4446-5p	CLIP-seq
MIRT1967382	hsa-miR-4667-3p	CLIP-seq
MIRT1967383	hsa-miR-637	CLIP-seq
MIRT1967384	hsa-miR-640	CLIP-seq
MIRT901299	hsa-miR-4303	CLIP-seq
MIRT901308	hsa-miR-4659a-3p	CLIP-seq
MIRT901309	hsa-miR-4659b-3p	CLIP-seq
MIRT901310	hsa-miR-4682	CLIP-seq
MIRT901313	hsa-miR-4762-3p	CLIP-seq
MIRT901314	hsa-miR-4762-5p	CLIP-seq
MIRT2447349	hsa-miR-579	CLIP-seq
MIRT901323	hsa-miR-627	CLIP-seq
MIRT901325	hsa-miR-924	CLIP-seq
MIRT901299	hsa-miR-4303	CLIP-seq
MIRT901308	hsa-miR-4659a-3p	CLIP-seq
MIRT901309	hsa-miR-4659b-3p	CLIP-seq
MIRT901310	hsa-miR-4682	CLIP-seq
MIRT901313	hsa-miR-4762-3p	CLIP-seq
MIRT901314	hsa-miR-4762-5p	CLIP-seq
MIRT2447349	hsa-miR-579	CLIP-seq
MIRT901323	hsa-miR-627	CLIP-seq
MIRT901325	hsa-miR-924	CLIP-seq
MIRT901313	hsa-miR-4762-3p	CLIP-seq
MIRT901314	hsa-miR-4762-5p	CLIP-seq

Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	12826659, 32296183
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	ISS	22378787
GO:0010988	Process	Regulation of low-density lipoprotein particle clearance	IEA
GO:0010988	Process	Regulation of low-density lipoprotein particle clearance	ISS	22378787

MIM	HGNC	e!Ensembl
605861	13529	ENSG00000257727

Q9Y2B0

Protein name

Protein canopy homolog 2 (MIR-interacting saposin-like protein) (Putative secreted protein Zsig9) (Transmembrane protein 4)

Protein function

Positive regulator of neurite outgrowth by stabilizing myosin regulatory light chain (MRLC). It prevents MIR-mediated MRLC ubiquitination and its subsequent proteasomal degradation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF11938	DUF3456	27 → 171	TLR4 regulator and MIR-interacting MSAP	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in different tissues. Highest levels are detected in adult placenta, liver and pancreas. {ECO:0000269|PubMed:12826659}.

Sequence

MKGWGWLALLLGALLGTAWARRSQDLHCGACRALVDELEWEIAQVDPKKTIQMGSFRINP
DGSQSVVEVPYARSEAHLTELLEEICDRMKEYGEQIDPSTHRKNYVRVVGRNGESSELDL
QGIRIDSDISGTLKFACESIVEEYEDELIEFFSREADNVKDKLCSKRTDLCDHALHISHD
EL

Sequence length

182

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Abnormality of the face	Likely pathogenic	rs1873865063	RCV002226937	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Craniosynostosis syndrome	Likely pathogenic	rs1873865063	RCV002226937	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRANIOSYNOSTOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (26)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute pancreatitis	Pancreatitis	BEFREE	30473463, 31774228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	29569784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26835537, 29135454, 30070972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	26835537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29135454, 30070972, 35924107	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	31047986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28235487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	31047986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	21364753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperchloremia	Hyperchloremia	BEFREE	30473463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Islet Cell Tumor	Islet Cell Tumor	BEFREE	29849941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30473463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30415246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	25117438, 29707137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	21364753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26835537		★★★★★ ★☆☆☆☆ Found in Text Mining only
MUTYH-Associate Polyposis	Polyposis	BEFREE	31774228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	31047986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26835537, 29849941, 30415246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29569784, 29864955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	25365448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	25117438, 29707137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28235487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	29569784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28603065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	21364753		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

CNPY2 (canopy FGF signaling regulator 2)