Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	1033
Gene name	Cyclin dependent kinase inhibitor 3
Gene symbol	CDKN3
Synonyms (NCBI Gene)	CDI1CIP2KAPKAP1
Chromosome	14
Chromosome location	14q22.2
Summary	The protein encoded by this gene belongs to the dual specificity protein phosphatase family. It was identified as a cyclin-dependent kinase inhibitor, and has been shown to interact with, and dephosphorylate CDK2 kinase, thus prevent the activation of CDK

125

Show/Hide all (125)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005705	hsa-miR-146a-5p	Western blot	19944095
MIRT024518	hsa-miR-215-5p	Microarray	19074876
MIRT026751	hsa-miR-192-5p	Microarray	19074876
MIRT049159	hsa-miR-92a-3p	CLASH	23622248
MIRT642630	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT642629	hsa-miR-6801-3p	HITS-CLIP	23824327
MIRT642628	hsa-miR-6810-3p	HITS-CLIP	23824327
MIRT642627	hsa-miR-331-3p	HITS-CLIP	23824327
MIRT642626	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT642625	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT642624	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT642623	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT642622	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT642621	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT642620	hsa-miR-4284	HITS-CLIP	23824327
MIRT642619	hsa-miR-7641	HITS-CLIP	23824327
MIRT642618	hsa-miR-3689d	HITS-CLIP	23824327
MIRT642617	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT642630	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT642629	hsa-miR-6801-3p	HITS-CLIP	23824327
MIRT642628	hsa-miR-6810-3p	HITS-CLIP	23824327
MIRT642627	hsa-miR-331-3p	HITS-CLIP	23824327
MIRT642626	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT642625	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT642624	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT642623	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT642622	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT642621	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT642620	hsa-miR-4284	HITS-CLIP	23824327
MIRT642619	hsa-miR-7641	HITS-CLIP	23824327
MIRT642618	hsa-miR-3689d	HITS-CLIP	23824327
MIRT642617	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT881888	hsa-miR-1297	CLIP-seq
MIRT881889	hsa-miR-141	CLIP-seq
MIRT881890	hsa-miR-181a	CLIP-seq
MIRT881891	hsa-miR-181b	CLIP-seq
MIRT881892	hsa-miR-181c	CLIP-seq
MIRT881893	hsa-miR-181d	CLIP-seq
MIRT881894	hsa-miR-200a	CLIP-seq
MIRT881895	hsa-miR-26a	CLIP-seq
MIRT881896	hsa-miR-26b	CLIP-seq
MIRT881897	hsa-miR-3161	CLIP-seq
MIRT881898	hsa-miR-323-5p	CLIP-seq
MIRT881899	hsa-miR-4262	CLIP-seq
MIRT881900	hsa-miR-4456	CLIP-seq
MIRT881901	hsa-miR-4465	CLIP-seq
MIRT881902	hsa-miR-579	CLIP-seq
MIRT881903	hsa-miR-876-3p	CLIP-seq
MIRT881888	hsa-miR-1297	CLIP-seq
MIRT881904	hsa-miR-1324	CLIP-seq
MIRT881889	hsa-miR-141	CLIP-seq
MIRT881890	hsa-miR-181a	CLIP-seq
MIRT881891	hsa-miR-181b	CLIP-seq
MIRT881892	hsa-miR-181c	CLIP-seq
MIRT881893	hsa-miR-181d	CLIP-seq
MIRT881894	hsa-miR-200a	CLIP-seq
MIRT881895	hsa-miR-26a	CLIP-seq
MIRT881896	hsa-miR-26b	CLIP-seq
MIRT881905	hsa-miR-3130-3p	CLIP-seq
MIRT881906	hsa-miR-3146	CLIP-seq
MIRT881897	hsa-miR-3161	CLIP-seq
MIRT881898	hsa-miR-323-5p	CLIP-seq
MIRT881907	hsa-miR-3942-3p	CLIP-seq
MIRT881899	hsa-miR-4262	CLIP-seq
MIRT881900	hsa-miR-4456	CLIP-seq
MIRT881901	hsa-miR-4465	CLIP-seq
MIRT881908	hsa-miR-4686	CLIP-seq
MIRT881909	hsa-miR-4793-3p	CLIP-seq
MIRT881910	hsa-miR-548a-3p	CLIP-seq
MIRT881911	hsa-miR-548e	CLIP-seq
MIRT881912	hsa-miR-548f	CLIP-seq
MIRT881902	hsa-miR-579	CLIP-seq
MIRT881913	hsa-miR-651	CLIP-seq
MIRT881903	hsa-miR-876-3p	CLIP-seq
MIRT881888	hsa-miR-1297	CLIP-seq
MIRT881904	hsa-miR-1324	CLIP-seq
MIRT881889	hsa-miR-141	CLIP-seq
MIRT881890	hsa-miR-181a	CLIP-seq
MIRT881891	hsa-miR-181b	CLIP-seq
MIRT881892	hsa-miR-181c	CLIP-seq
MIRT881893	hsa-miR-181d	CLIP-seq
MIRT881894	hsa-miR-200a	CLIP-seq
MIRT881895	hsa-miR-26a	CLIP-seq
MIRT881896	hsa-miR-26b	CLIP-seq
MIRT881905	hsa-miR-3130-3p	CLIP-seq
MIRT881906	hsa-miR-3146	CLIP-seq
MIRT881897	hsa-miR-3161	CLIP-seq
MIRT881898	hsa-miR-323-5p	CLIP-seq
MIRT881907	hsa-miR-3942-3p	CLIP-seq
MIRT881899	hsa-miR-4262	CLIP-seq
MIRT881900	hsa-miR-4456	CLIP-seq
MIRT881901	hsa-miR-4465	CLIP-seq
MIRT881908	hsa-miR-4686	CLIP-seq
MIRT881909	hsa-miR-4793-3p	CLIP-seq
MIRT881910	hsa-miR-548a-3p	CLIP-seq
MIRT881911	hsa-miR-548e	CLIP-seq
MIRT881912	hsa-miR-548f	CLIP-seq
MIRT881902	hsa-miR-579	CLIP-seq
MIRT881913	hsa-miR-651	CLIP-seq
MIRT881903	hsa-miR-876-3p	CLIP-seq
MIRT881888	hsa-miR-1297	CLIP-seq
MIRT881889	hsa-miR-141	CLIP-seq
MIRT2198004	hsa-miR-146a	CLIP-seq
MIRT2198005	hsa-miR-146b-5p	CLIP-seq
MIRT881890	hsa-miR-181a	CLIP-seq
MIRT881891	hsa-miR-181b	CLIP-seq
MIRT881892	hsa-miR-181c	CLIP-seq
MIRT881893	hsa-miR-181d	CLIP-seq
MIRT881894	hsa-miR-200a	CLIP-seq
MIRT881895	hsa-miR-26a	CLIP-seq
MIRT881896	hsa-miR-26b	CLIP-seq
MIRT2198006	hsa-miR-3123	CLIP-seq
MIRT881905	hsa-miR-3130-3p	CLIP-seq
MIRT881906	hsa-miR-3146	CLIP-seq
MIRT881897	hsa-miR-3161	CLIP-seq
MIRT881898	hsa-miR-323-5p	CLIP-seq
MIRT2198007	hsa-miR-3925-5p	CLIP-seq
MIRT881899	hsa-miR-4262	CLIP-seq
MIRT881900	hsa-miR-4456	CLIP-seq
MIRT881901	hsa-miR-4465	CLIP-seq
MIRT881908	hsa-miR-4686	CLIP-seq
MIRT881909	hsa-miR-4793-3p	CLIP-seq
MIRT881902	hsa-miR-579	CLIP-seq
MIRT881913	hsa-miR-651	CLIP-seq
MIRT881903	hsa-miR-876-3p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
YBX1	Activation	20596676

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000079	Process	Regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	8242750
GO:0000082	Process	G1/S transition of mitotic cell cycle	TAS	8127873
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004722	Function	Protein serine/threonine phosphatase activity	IDA	12745075
GO:0004722	Function	Protein serine/threonine phosphatase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	IBA
GO:0004725	Function	Protein tyrosine phosphatase activity	IDA	8242750
GO:0004725	Function	Protein tyrosine phosphatase activity	IEA
GO:0005515	Function	Protein binding	IPI	8242750, 9840943, 11463386, 15530371, 15671017, 24218572, 25852190, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0008138	Function	Protein tyrosine/serine/threonine phosphatase activity	TAS	8242750
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	8242750
GO:0016787	Function	Hydrolase activity	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	10669749
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0051726	Process	Regulation of cell cycle	IDA	8242750
GO:0051726	Process	Regulation of cell cycle	TAS	8242750

MIM	HGNC	e!Ensembl
123832	1791	ENSG00000100526

Q16667

Protein name

Cyclin-dependent kinase inhibitor 3 (EC 3.1.3.16) (EC 3.1.3.48) (CDK2-associated dual-specificity phosphatase) (Cyclin-dependent kinase interactor 1) (Cyclin-dependent kinase-interacting protein 2) (Kinase-associated phosphatase)

Protein function

May play a role in cell cycle regulation. Dual specificity CC phosphatase active toward substrates containing either phosphotyrosine or phosphoserine residues (PubMed:8127873, PubMed:8242750). Dephosphorylates CDK2 at 'Thr-160' in a cyclin-depen

PDB

1FPZ , 1FQ1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05706	CDKN3	1 → 168	Cyclin-dependent kinase inhibitor 3 (CDKN3)	Domain

Sequence

MKPPSSIQTSEFDSSDEEPIEDEQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNV
QKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCC
EIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAI
QTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR

Sequence length

212

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (143)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute leukemia	Leukemia	BEFREE	15755508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	31076446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	26554648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	15994756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	15767045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	32147961	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	23306186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	24423316		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	29168185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	12495933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	15860714	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	17210692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	22713662, 25032865	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	12675762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	23775190	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10319992, 17911387, 19720293, 23991171, 25421577, 27314680, 9515786, 9636670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27314680, 39738567	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	27314282, 27983933, 9365157	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11309512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21535270, 22539975, 27314282, 29843214, 29962817, 30702595, 31043166, 31822116, 32000807, 32721244, 33688500, 33784984, 33946043, 34315286, 35030478	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29917268, 9891228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	26191143	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35678231, 37682177	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	9889406	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	11720438	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15475444, 25548895, 26191143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinomatosis of peritoneal cavity	Peritoneal Carcinomatosis	BEFREE	19898899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	28716248	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	18232003, 23405241, 23991171, 25152075, 26372210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	15492761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	18232003, 23405241, 23991171, 25152075, 26372210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	25152075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic interstitial cystitis	Interstitial Cystitis	BEFREE	29729649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	12675762, 16565223, 26606677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	23665236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25735390, 29527286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18360708, 32329836	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	9194578, 9724087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	31196189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	31196189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	23707792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	1338721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	11334908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	25548895, 26191143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erythema Multiforme	Erythema	BEFREE	10571738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	10656678, 31114363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	10656678, 31114363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	26004606, 34044866, 36259348	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	21685936	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	17210692, 24704824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	17210692, 24704824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29306210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	19657189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	38030294	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	10498617, 9927059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	10498617	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	8946928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	12745075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	21453471	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	7632961, 9116298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism	Hyperparathyroidism	Pubtator	18288099	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	34637697, 36140669	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	34580317	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	29729649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	30545246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	30545246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28716248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile polyp	Polyp	BEFREE	9060832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	24741090, 25995248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	31076446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10094816, 10987270, 14759525, 22390936, 22539975, 23292002, 27095111, 27314282, 9185756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	UNIPROT_DG	10987270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	21535270, 32000807	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	27314282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	10094816, 27095111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35178291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	34044866	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	21453471	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	21453471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	31743514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	19657189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10319992, 17911387, 19720293, 21717460, 23991171, 25421577, 27314680, 9515786, 9636670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	10656678, 31114363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	19728335, 27314282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29917268, 9891228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25548895, 26191143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21768779, 24861921, 29168185, 9252195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10353729, 10669749, 15545300, 27780869, 29196103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of salivary gland	Malignant neoplasm of salivary gland	BEFREE	12725323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19898899, 23548070, 27983933, 7889467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10812241, 12570330, 15737564, 17016600, 17210692, 18316600, 19449443, 20569236, 23505216, 24465590, 25152075, 26191143, 26554648, 27842055, 28109073 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	18232003, 23405241, 23991171, 25152075, 26372210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	23665236		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11500805, 9724087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	22878367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	29616856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	34083581	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia	Multiple Endocrine Neoplasia	BEFREE	23933118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 1	Multiple Endocrine Neoplasia	BEFREE	19141585, 23715670, 23933118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11278272, 11886382	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	19151776, 29616856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	15536518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Facioscapulohumeral	Facioscapulohumeral Muscular Dystrophy	BEFREE	12868502		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	11435325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	10997587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	38030294	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28109073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	30013440	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10211947, 10515227, 10721718, 11165393, 11212232, 12009890, 12468628, 15715087, 16412137, 17488337, 19390090, 19449443, 19466588, 19728335, 19770839 View all (36 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	8971182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	15147518, 26202950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	28246384	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30628487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	39256343	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	16314512		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	25548895, 26191143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26191143	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	29196103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21768779, 24861921, 29168185, 9252195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	18190706, 35864471, 36828188, 7573363	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	15929668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	25152075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Adenoma	Parathyroid Adenoma	BEFREE	23715670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid neoplasm	Pubtator	23715670	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	9365157	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10353729, 10669749, 27780869, 29196103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33630978, 34198380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23292002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	27965411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	19020765, 21717460, 31648931, 9861348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	16802342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	11084299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	29845250	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11850838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	12478659, 26004606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	16449678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19898899, 23548070, 27983933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23548070, 27983933, 33351778, 34135559	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35446856	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	11251953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	15492761, 35008799	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23405241, 26372210	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CDKN3 (cyclin dependent kinase inhibitor 3)