Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10326
Gene name	Signal regulatory protein beta 1
Gene symbol	SIRPB1
Synonyms (NCBI Gene)	CD172bSIRB1SIRP-BETA-1
Chromosome	20
Chromosome location	20p13
Summary	The protein encoded by this gene is a member of the signal-regulatory-protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulat

Show/Hide all (79)

miRTarBase ID	miRNA	Experiments	Reference
MIRT739081	hsa-miR-942	HITS-CLIP	33718276
MIRT1349936	hsa-miR-1245b-3p	CLIP-seq
MIRT1349937	hsa-miR-1252	CLIP-seq
MIRT1349938	hsa-miR-1293	CLIP-seq
MIRT1349939	hsa-miR-1302	CLIP-seq
MIRT1349940	hsa-miR-1321	CLIP-seq
MIRT1349941	hsa-miR-1827	CLIP-seq
MIRT1349942	hsa-miR-3165	CLIP-seq
MIRT1349943	hsa-miR-3173-3p	CLIP-seq
MIRT1349944	hsa-miR-3192	CLIP-seq
MIRT1349945	hsa-miR-3612	CLIP-seq
MIRT1349946	hsa-miR-3646	CLIP-seq
MIRT1349947	hsa-miR-3661	CLIP-seq
MIRT1349948	hsa-miR-3662	CLIP-seq
MIRT1349949	hsa-miR-3689d	CLIP-seq
MIRT1349950	hsa-miR-4270	CLIP-seq
MIRT1349951	hsa-miR-4282	CLIP-seq
MIRT1349952	hsa-miR-4298	CLIP-seq
MIRT1349953	hsa-miR-4318	CLIP-seq
MIRT1349954	hsa-miR-4419a	CLIP-seq
MIRT1349955	hsa-miR-4441	CLIP-seq
MIRT1349956	hsa-miR-4474-3p	CLIP-seq
MIRT1349957	hsa-miR-4483	CLIP-seq
MIRT1349958	hsa-miR-4499	CLIP-seq
MIRT1349959	hsa-miR-4510	CLIP-seq
MIRT1349960	hsa-miR-4514	CLIP-seq
MIRT1349961	hsa-miR-4635	CLIP-seq
MIRT1349962	hsa-miR-4651	CLIP-seq
MIRT1349963	hsa-miR-4692	CLIP-seq
MIRT1349964	hsa-miR-4695-5p	CLIP-seq
MIRT1349965	hsa-miR-4728-5p	CLIP-seq
MIRT1349966	hsa-miR-4739	CLIP-seq
MIRT1349967	hsa-miR-4756-5p	CLIP-seq
MIRT1349968	hsa-miR-4779	CLIP-seq
MIRT1349969	hsa-miR-608	CLIP-seq
MIRT1349970	hsa-miR-631	CLIP-seq
MIRT1349971	hsa-miR-650	CLIP-seq
MIRT1349972	hsa-miR-765	CLIP-seq
MIRT1349973	hsa-miR-922	CLIP-seq
MIRT1349974	hsa-miR-1207-5p	CLIP-seq
MIRT739083	hsa-miR-1226	CLIP-seq
MIRT739085	hsa-miR-1229	CLIP-seq
MIRT1349975	hsa-miR-1343	CLIP-seq
MIRT1349976	hsa-miR-1909	CLIP-seq
MIRT1349977	hsa-miR-3074-5p	CLIP-seq
MIRT739082	hsa-miR-3127-3p	CLIP-seq
MIRT1349944	hsa-miR-3192	CLIP-seq
MIRT1349978	hsa-miR-3613-5p	CLIP-seq
MIRT1349979	hsa-miR-3688-5p	CLIP-seq
MIRT1349980	hsa-miR-3689a-3p	CLIP-seq
MIRT1349981	hsa-miR-3689c	CLIP-seq
MIRT1349949	hsa-miR-3689d	CLIP-seq
MIRT1349982	hsa-miR-4687-3p	CLIP-seq
MIRT1349983	hsa-miR-4716-5p	CLIP-seq
MIRT1349965	hsa-miR-4728-5p	CLIP-seq
MIRT739084	hsa-miR-4733-3p	CLIP-seq
MIRT1349984	hsa-miR-4736	CLIP-seq
MIRT1349985	hsa-miR-4747-5p	CLIP-seq
MIRT1349986	hsa-miR-4763-3p	CLIP-seq
MIRT739080	hsa-miR-4768-5p	CLIP-seq
MIRT1349968	hsa-miR-4779	CLIP-seq
MIRT1349987	hsa-miR-485-5p	CLIP-seq
MIRT1349988	hsa-miR-630	CLIP-seq
MIRT1349972	hsa-miR-765	CLIP-seq
MIRT1349983	hsa-miR-4716-5p	CLIP-seq
MIRT1349974	hsa-miR-1207-5p	CLIP-seq
MIRT1349976	hsa-miR-1909	CLIP-seq
MIRT1349979	hsa-miR-3688-5p	CLIP-seq
MIRT1349983	hsa-miR-4716-5p	CLIP-seq
MIRT1349984	hsa-miR-4736	CLIP-seq
MIRT1349986	hsa-miR-4763-3p	CLIP-seq
MIRT1349972	hsa-miR-765	CLIP-seq
MIRT1349974	hsa-miR-1207-5p	CLIP-seq
MIRT1349976	hsa-miR-1909	CLIP-seq
MIRT1349979	hsa-miR-3688-5p	CLIP-seq
MIRT1349983	hsa-miR-4716-5p	CLIP-seq
MIRT1349984	hsa-miR-4736	CLIP-seq
MIRT1349986	hsa-miR-4763-3p	CLIP-seq
MIRT1349972	hsa-miR-765	CLIP-seq

Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	10940905, 25416956, 32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9062191
GO:0007165	Process	Signal transduction	TAS	9062191
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	9062191
GO:0009986	Component	Cell surface	TAS	25795378
GO:0016020	Component	Membrane	IEA
GO:0030667	Component	Secretory granule membrane	TAS
GO:0050766	Process	Positive regulation of phagocytosis	IBA
GO:0050870	Process	Positive regulation of T cell activation	IBA

MIM	HGNC	e!Ensembl
603889	15928	ENSG00000101307

O00241

Protein name

Signal-regulatory protein beta-1 (SIRP-beta-1) (CD172 antigen-like family member B) (CD antigen CD172b)

Protein function

Immunoglobulin-like cell surface receptor involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. Also participates in the recruitment of tyrosine kinase SYK. Triggers activation of myeloid cells when associa

PDB

2D9C , 2JJU

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	37 → 144	Immunoglobulin V-set domain	Domain
PF07654	C1-set	151 → 234	Immunoglobulin C1-set domain	Domain
PF07654	C1-set	254 → 337	Immunoglobulin C1-set domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in monocytes and dendritic cells. {ECO:0000269|PubMed:10604985}.

Sequence

MPVPASWPHLPSPFLLMTLLLGRLTGVAGEDELQVIQPEKSVSVAAGESATLRCAMTSLI
PVGPIMWFRGAGAGRELIYNQKEGHFPRVTTVSELTKRNNLDFSISISNITPADAGTYYC
VKFRKGSPDDVEFKSGAGTELSVRAKPSAPVVSGPAVRATPEHTVSFTCESHGFSPRDIT
LKWFKNGNELSDFQTNVDPAGDSVSYSIHSTARVVLTRGDVHSQVICEIAHITLQGDPLR
GTANLSEAIRVPPTLEVTQQPMRAENQANVTCQVSNFYPRGLQLTWLENGNVSRTETAST
LIENKDGTYNWMSWLLVNTCAHRDDVVLTCQVEHDGQQAVSKSYALEISAHQKEHGSDIT
HEAALAPTAPLLVALLLGPKLLLVVGVSAIYICWKQKA

Sequence length

398

Q5TFQ8

Protein name

Signal-regulatory protein beta-1 isoform 3 (SIRP-beta-1 isoform 3)

Protein function

Immunoglobulin-like cell surface receptor involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes.

PDB

2JJV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	37 → 144	Immunoglobulin V-set domain	Domain
PF07654	C1-set	151 → 234	Immunoglobulin C1-set domain	Domain
PF07654	C1-set	255 → 337	Immunoglobulin C1-set domain	Domain

Sequence

MPVPASWPHLPSPFLLMTLLLGRLTGVAGEEELQVIQPDKSISVAAGESATLHCTVTSLI
PVGPIQWFRGAGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISNITPADAGTYYC
VKFRKGSPDHVEFKSGAGTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDIT
LKWFKNGNELSDFQTNVDPAGDSVSYSIHSTAKVVLTREDVHSQVICEVAHVTLQGDPLR
GTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVRKFYPQRLQLTWLENGNVSRTETAST
LTENKDGTYNWMSWLLVNVSAHRDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNTA
PGPALASAAPLLIAFLLGPKVLLVVGVSVIYVYWKQKA

Sequence length

398

Interactions

View interactions

	KEGG		Reactome
	Efferocytosis Osteoclast differentiation		DAP12 interactions Signal regulatory protein family interactions Neutrophil degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (12)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	37438770	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	35967305	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	35721735	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27058892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	22110671	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21551127	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Reticulosarcoma	Reticulosarcoma	BEFREE	22890838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	19034380, 19165527		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	24564241, 25039969		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	24564241, 25039969		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	24564241	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23405089	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SIRPB1 (signal regulatory protein beta 1)