Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10325
Gene name	Ras related GTP binding B
Gene symbol	RRAGB
Synonyms (NCBI Gene)	RAGBbA465E19.1
Chromosome	X
Chromosome location	Xp11.21
Summary	Ras-homologous GTPases constitute a large family of signal transducers that alternate between an activated, GTP-binding state and an inactivated, GDP-binding state. These proteins represent cellular switches that are operated by GTP-exchange factors and f

Show/Hide all (7)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019667	hsa-miR-375	Microarray	20215506
MIRT2614909	hsa-miR-155	CLIP-seq
MIRT2614910	hsa-miR-4251	CLIP-seq
MIRT2614911	hsa-miR-4663	CLIP-seq
MIRT2614912	hsa-miR-4728-3p	CLIP-seq
MIRT2614913	hsa-miR-539	CLIP-seq
MIRT2614914	hsa-miR-570	CLIP-seq

Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IEA
GO:0005515	Function	Protein binding	IPI	11073942, 20381137, 22424946, 22575674, 23394946, 25259925, 25561175, 25567906, 33961781
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IDA	7499430
GO:0005525	Function	GTP binding	IEA
GO:0005525	Function	GTP binding	IMP	22424946, 23723238
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IDA	9394008
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	IBA
GO:0005764	Component	Lysosome	IDA	20381137
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005829	Component	Cytosol	TAS
GO:0008104	Process	Intracellular protein localization	IMP	20381137
GO:0009267	Process	Cellular response to starvation	IBA
GO:0010507	Process	Negative regulation of autophagy	IBA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0032006	Process	Regulation of TOR signaling	IGI	23723238
GO:0032008	Process	Positive regulation of TOR signaling	IMP	22575674
GO:0032561	Function	Guanyl ribonucleotide binding	IDA	22575674
GO:0034198	Process	Cellular response to amino acid starvation	IEA
GO:0034198	Process	Cellular response to amino acid starvation	IGI	23723238
GO:0051020	Function	GTPase binding	IPI	22424946
GO:0071230	Process	Cellular response to amino acid stimulus	IEA
GO:0071230	Process	Cellular response to amino acid stimulus	IMP	20381137
GO:1904263	Process	Positive regulation of TORC1 signaling	IBA
GO:1904263	Process	Positive regulation of TORC1 signaling	IEA
GO:1904263	Process	Positive regulation of TORC1 signaling	IMP	22424946
GO:1990131	Component	Gtr1-Gtr2 GTPase complex	IBA
GO:1990253	Process	Cellular response to leucine starvation	IMP	22424946

MIM	HGNC	e!Ensembl
300725	19901	ENSG00000083750

Q5VZM2

Protein name

Ras-related GTP-binding protein B (Rag B) (RagB) (EC 3.6.5.-)

Protein function

Guanine nucleotide-binding protein that plays a crucial role in the cellular response to amino acid availability through regulation of the mTORC1 signaling cascade (PubMed:18497260, PubMed:20381137, PubMed:23723238, PubMed:24095279). Forms heter

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04670	Gtr1_RagA	42 → 296	Gtr1/RagA G protein conserved region	Domain

Sequence

MEESDSEKTTEKENLGPRMDPPLGEPEGSLGWVLPNTAMKKKVLLMGKSGSGKTSMRSII
FANYIARDTRRLGATILDRIHSLQINSSLSTYSLVDSVGNTKTFDVEHSHVRFLGNLVLN
LWDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPD
AKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECSCFRTSIWDETLYKAWSSIVYQ
LIPNVQQLEMNLRNFAEIIEADEVLLFERATFLVISHYQCKEQRDAHRFEKISNIIKQFK
LSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEK
LERVDGPKQCLLMR

Sequence length

374

Interactions

View interactions

	KEGG		Reactome
	Autophagy - animal mTOR signaling pathway Shigellosis		Macroautophagy mTOR signalling mTORC1-mediated signalling Energy dependent regulation of mTOR by LKB1-AMPK TP53 Regulates Metabolic Genes Regulation of PTEN gene transcription Amino acids regulate mTORC1

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (3)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Colonic Neoplasms	Colonic neoplasm	Pubtator	34320917	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35739524	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	25418117	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RRAGB (Ras related GTP binding B)