Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10318
Gene name	TNFAIP3 interacting protein 1
Gene symbol	TNIP1
Synonyms (NCBI Gene)	ABIN-1NAF1VANnip40-1
Chromosome	5
Chromosome location	5q33.1
Summary	This gene encodes an A20-binding protein which plays a role in autoimmunity and tissue homeostasis through the regulation of nuclear factor kappa-B activation. Mutations in this gene have been associated with psoriatic arthritis, rheumatoid arthritis, and

154

Show/Hide all (154)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024151	hsa-miR-221-3p	Sequencing	20371350
MIRT047340	hsa-miR-181a-5p	CLASH	23622248
MIRT042899	hsa-miR-324-3p	CLASH	23622248
MIRT438115	hsa-miR-517a-3p	Luciferase reporter assay	23448136
MIRT438115	hsa-miR-517a-3p	Luciferase reporter assay	23448136
MIRT518709	hsa-miR-582-3p	HITS-CLIP	21572407
MIRT518704	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT518708	hsa-miR-625-3p	HITS-CLIP	21572407
MIRT518707	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT518705	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT518708	hsa-miR-625-3p	PAR-CLIP	21572407
MIRT518707	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT518705	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT518704	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT518709	hsa-miR-582-3p	PAR-CLIP	23446348
MIRT518708	hsa-miR-625-3p	PAR-CLIP	23446348
MIRT518707	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT518706	hsa-miR-885-5p	PAR-CLIP	23446348
MIRT518705	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT518704	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT726260	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT726259	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT518709	hsa-miR-582-3p	HITS-CLIP	21572407
MIRT518704	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT518708	hsa-miR-625-3p	HITS-CLIP	21572407
MIRT518707	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT518705	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT518708	hsa-miR-625-3p	PAR-CLIP	21572407
MIRT518707	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT518705	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT518704	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT518709	hsa-miR-582-3p	PAR-CLIP	23446348
MIRT518708	hsa-miR-625-3p	PAR-CLIP	23446348
MIRT518707	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT518706	hsa-miR-885-5p	PAR-CLIP	23446348
MIRT518705	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT518704	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT1443619	hsa-miR-1255a	CLIP-seq
MIRT1443620	hsa-miR-1255b	CLIP-seq
MIRT1443621	hsa-miR-19a	CLIP-seq
MIRT1443622	hsa-miR-19b	CLIP-seq
MIRT1443623	hsa-miR-3183	CLIP-seq
MIRT1443624	hsa-miR-4685-5p	CLIP-seq
MIRT1443625	hsa-miR-4723-3p	CLIP-seq
MIRT1443626	hsa-miR-4757-5p	CLIP-seq
MIRT1443627	hsa-miR-517a	CLIP-seq
MIRT1443628	hsa-miR-517b	CLIP-seq
MIRT1443629	hsa-miR-517c	CLIP-seq
MIRT2132748	hsa-miR-2052	CLIP-seq
MIRT2132749	hsa-miR-221	CLIP-seq
MIRT2132750	hsa-miR-222	CLIP-seq
MIRT2132751	hsa-miR-2467-5p	CLIP-seq
MIRT2132752	hsa-miR-3188	CLIP-seq
MIRT2132753	hsa-miR-370	CLIP-seq
MIRT2132754	hsa-miR-3975	CLIP-seq
MIRT2132755	hsa-miR-4267	CLIP-seq
MIRT2132756	hsa-miR-4497	CLIP-seq
MIRT2132757	hsa-miR-4649-3p	CLIP-seq
MIRT2132758	hsa-miR-4677-3p	CLIP-seq
MIRT2132759	hsa-miR-4736	CLIP-seq
MIRT2132760	hsa-miR-4797-5p	CLIP-seq
MIRT2132761	hsa-miR-485-5p	CLIP-seq
MIRT2132762	hsa-miR-486-3p	CLIP-seq
MIRT2132763	hsa-miR-532-3p	CLIP-seq
MIRT2132764	hsa-miR-548v	CLIP-seq
MIRT2132765	hsa-miR-760	CLIP-seq
MIRT2353838	hsa-miR-1299	CLIP-seq
MIRT2353839	hsa-miR-3127-5p	CLIP-seq
MIRT2353840	hsa-miR-4701-5p	CLIP-seq
MIRT2353841	hsa-miR-4782-5p	CLIP-seq
MIRT2353842	hsa-miR-516b	CLIP-seq
MIRT2353843	hsa-miR-588	CLIP-seq
MIRT2396142	hsa-miR-1910	CLIP-seq
MIRT2396143	hsa-miR-2355-5p	CLIP-seq
MIRT2396144	hsa-miR-30a	CLIP-seq
MIRT2396145	hsa-miR-30b	CLIP-seq
MIRT2396146	hsa-miR-30c	CLIP-seq
MIRT2396147	hsa-miR-30d	CLIP-seq
MIRT2396148	hsa-miR-30e	CLIP-seq
MIRT2396149	hsa-miR-3607-3p	CLIP-seq
MIRT2396150	hsa-miR-486-5p	CLIP-seq
MIRT2647949	hsa-miR-1182	CLIP-seq
MIRT2647950	hsa-miR-1252	CLIP-seq
MIRT2647951	hsa-miR-1266	CLIP-seq
MIRT2647952	hsa-miR-140-3p	CLIP-seq
MIRT2647953	hsa-miR-150	CLIP-seq
MIRT2647954	hsa-miR-193a-5p	CLIP-seq
MIRT2132748	hsa-miR-2052	CLIP-seq
MIRT2353839	hsa-miR-3127-5p	CLIP-seq
MIRT2647955	hsa-miR-3156-3p	CLIP-seq
MIRT2647956	hsa-miR-3159	CLIP-seq
MIRT2647957	hsa-miR-3179	CLIP-seq
MIRT2647958	hsa-miR-3202	CLIP-seq
MIRT2647959	hsa-miR-3675-5p	CLIP-seq
MIRT2647960	hsa-miR-3918	CLIP-seq
MIRT2132755	hsa-miR-4267	CLIP-seq
MIRT2647961	hsa-miR-4268	CLIP-seq
MIRT2647962	hsa-miR-4301	CLIP-seq
MIRT2647963	hsa-miR-4448	CLIP-seq
MIRT2647964	hsa-miR-4476	CLIP-seq
MIRT2132756	hsa-miR-4497	CLIP-seq
MIRT2647965	hsa-miR-4518	CLIP-seq
MIRT2647966	hsa-miR-4539	CLIP-seq
MIRT2647967	hsa-miR-4650-5p	CLIP-seq
MIRT2132758	hsa-miR-4677-3p	CLIP-seq
MIRT2647968	hsa-miR-4679	CLIP-seq
MIRT1443624	hsa-miR-4685-5p	CLIP-seq
MIRT2647969	hsa-miR-4713-5p	CLIP-seq
MIRT2132763	hsa-miR-532-3p	CLIP-seq
MIRT2647970	hsa-miR-604	CLIP-seq
MIRT2647971	hsa-miR-615-5p	CLIP-seq
MIRT2647972	hsa-miR-647	CLIP-seq
MIRT2647973	hsa-miR-651	CLIP-seq
MIRT2647974	hsa-miR-766	CLIP-seq
MIRT2647949	hsa-miR-1182	CLIP-seq
MIRT2647950	hsa-miR-1252	CLIP-seq
MIRT2647951	hsa-miR-1266	CLIP-seq
MIRT2647952	hsa-miR-140-3p	CLIP-seq
MIRT2647953	hsa-miR-150	CLIP-seq
MIRT2647954	hsa-miR-193a-5p	CLIP-seq
MIRT2132748	hsa-miR-2052	CLIP-seq
MIRT2693752	hsa-miR-2861	CLIP-seq
MIRT2353839	hsa-miR-3127-5p	CLIP-seq
MIRT2647955	hsa-miR-3156-3p	CLIP-seq
MIRT2647956	hsa-miR-3159	CLIP-seq
MIRT2647957	hsa-miR-3179	CLIP-seq
MIRT2647958	hsa-miR-3202	CLIP-seq
MIRT2693753	hsa-miR-3612	CLIP-seq
MIRT2647959	hsa-miR-3675-5p	CLIP-seq
MIRT2693754	hsa-miR-3690	CLIP-seq
MIRT2647960	hsa-miR-3918	CLIP-seq
MIRT2693755	hsa-miR-4254	CLIP-seq
MIRT2132755	hsa-miR-4267	CLIP-seq
MIRT2647961	hsa-miR-4268	CLIP-seq
MIRT2647962	hsa-miR-4301	CLIP-seq
MIRT2693756	hsa-miR-4443	CLIP-seq
MIRT2647963	hsa-miR-4448	CLIP-seq
MIRT2647964	hsa-miR-4476	CLIP-seq
MIRT2132756	hsa-miR-4497	CLIP-seq
MIRT2693757	hsa-miR-4512	CLIP-seq
MIRT2647965	hsa-miR-4518	CLIP-seq
MIRT2647966	hsa-miR-4539	CLIP-seq
MIRT2647967	hsa-miR-4650-5p	CLIP-seq
MIRT2132758	hsa-miR-4677-3p	CLIP-seq
MIRT2647968	hsa-miR-4679	CLIP-seq
MIRT1443624	hsa-miR-4685-5p	CLIP-seq
MIRT2647969	hsa-miR-4713-5p	CLIP-seq
MIRT2132763	hsa-miR-532-3p	CLIP-seq
MIRT2647970	hsa-miR-604	CLIP-seq
MIRT2647971	hsa-miR-615-5p	CLIP-seq
MIRT2647972	hsa-miR-647	CLIP-seq
MIRT2693758	hsa-miR-650	CLIP-seq
MIRT2647973	hsa-miR-651	CLIP-seq
MIRT2647974	hsa-miR-766	CLIP-seq

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	ISS
GO:0005515	Function	Protein binding	IPI	15474016, 16189514, 20010814, 21516116, 21988832, 23414517, 25416956, 25609649, 25910212, 26871637, 29892012, 30561431, 31515488, 32296183, 33961781, 35140242
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006412	Process	Translation	TAS	9923610
GO:0006952	Process	Defense response	TAS	9923610
GO:0006954	Process	Inflammatory response	IEA
GO:0007159	Process	Leukocyte cell-cell adhesion	IMP	17632516
GO:0009101	Process	Glycoprotein biosynthetic process	IDA	9923610
GO:0010604	Process	Positive regulation of macromolecule metabolic process	IEA
GO:0042802	Function	Identical protein binding	IPI	21988832, 25416956, 30561431, 32296183
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IBA
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IDA	16684768
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IEA
GO:0045071	Process	Negative regulation of viral genome replication	TAS	9923610
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0050729	Process	Positive regulation of inflammatory response	ISS
GO:0051019	Function	Mitogen-activated protein kinase binding	IBA
GO:0051019	Function	Mitogen-activated protein kinase binding	IDA	12220502
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IBA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IDA	12220502
GO:0071222	Process	Cellular response to lipopolysaccharide	IBA
GO:0080090	Process	Regulation of primary metabolic process	IEA
GO:1903003	Process	Positive regulation of protein deubiquitination	IDA	16684768

MIM	HGNC	e!Ensembl
607714	16903	ENSG00000145901

Q15025

Protein name

TNFAIP3-interacting protein 1 (A20-binding inhibitor of NF-kappa-B activation 1) (ABIN-1) (HIV-1 Nef-interacting protein) (Nef-associated factor 1) (Naf1) (Nip40-1) (Virion-associated nuclear shuttling protein) (VAN) (hVAN)

Protein function

Inhibits NF-kappa-B activation and TNF-induced NF-kappa-B-dependent gene expression by regulating TAX1BP1 and A20/TNFAIP3-mediated deubiquitination of IKBKG; proposed to link A20/TNFAIP3 to ubiquitinated IKBKG (PubMed:21885437). Involved in regu

PDB

7EAL , 7EAO , 7EB9 , 8YFK , 8YFL , 8YFM , 8YFN , 9D34

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Strongly expressed in peripheral blood lymphocytes, spleen and skeletal muscle, and is weakly expressed in the brain. In peripheral blood mononucleocytes, isoform 4 is mainly expressed and isoform 1 and isoform 7 are almost

Sequence

MEGRGPYRIYDPGGSVPSGEASAAFERLVKENSRLKEKMQGIKMLGELLEESQMEATRLR
QKAEELVKDNELLPPPSPSLGSFDPLAELTGKDSNVTASPTAPACPSDKPAPVQKPPSSG
TSSEFEVVTPEEQNSPESSSHANAMALGPLPREDGNLMLHLQRLETTLSVCAEEPDHGQL
FTHLGRMALEFNRLASKVHKNEQRTSILQTLCEQLRKENEALKAKLDKGLEQRDQAAERL
REENLELKKLLMSNGNKEGASGRPGSPKMEGTGKKAVAGQQQASVTAGKVPEVVALGAAE
KKVKMLEQQRSELLEVNKQWDQHFRSMKQQYEQKITELRQKLADLQKQVTDLEAEREQKQ
RDFDRKLLLAKSKIEMEETDKEQLTAEAKELRQKVKYLQDQLSPLTRQREYQEKEIQRLN
KALEEALSIQTPPSSPPTAFGSPEGAGALLRKQELVTQNELLKQQVKIFEEDFQRERSDR
ERMNEEKEELKKQVEKLQAQVTLSNAQLKAFKDEEKAREALRQQKRKAKASGERYHVEPH
PEHLCGAYPYAYPPMPAMVPHHGFEDWSQIRYPPPPMAMEHPPPLPNSRLFHLPEYTWRL
PCGGVRNPNQSSQVMDPPTARPTEPESPKNDREGPQ

Sequence length

636

Interactions

View interactions

	KEGG		Reactome
	Shigellosis		Ovarian tumor domain proteases

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (28)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic lateral sclerosis	Conflicting classifications of pathogenicity	ClinVar Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNE SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY SKIN DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYASTHENIA GRAVIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOSITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS VULGARIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIATIC ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLERODERMA, SYSTEMIC	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SICCA SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SJOGREN SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SJOGREN'S SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SJOGRENS SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog, GenCC, Orphanet GWAS catalog, GenCC, Orphanet GWAS catalog, GenCC, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (122)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	28931804		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	GWASCAT_DG	29566793		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	21339218, 31308453		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthralgia	Arthralgia	Pubtator	37280058	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	31020648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	21623003, 22298274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	20849588	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	20875338, 21623003, 22170493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	GWASCAT_DG	26626624, 30552173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	22694930		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	GWASDB_DG	22694930		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	22694930	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	CTD_human_DG	24453940		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	29559739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	21750679, 22896740, 23944604, 27129285, 30402506, 31804013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	GWASCAT_DG	23055271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	23944604, 31804013, 32231389	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	24788730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	16298037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23959881, 27621439, 30774867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	37751795	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33761643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	GWASCAT_DG	26974007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	29589214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31819484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	29100383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	26974007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	27744495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	26046540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	25574825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	29413846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28426722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28426722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	21266526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	25574825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocarditis	Endocarditis	BEFREE	22790538, 28373187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	28454086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	28454086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	28454086	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Exanthema	Exanthema	Pubtator	30543901	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Generalized pustular psoriasis	Pustular Psoriasis	BEFREE	27364786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28985021, 31691497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	31033479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	22087647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	17016622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	26382585	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	GWASCAT_DG	23055271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	31691497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	29930103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	22525270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	20849588	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	29589214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Libman-Sacks Disease	Nonbacterial verrucal endocardiosis	CTD_human_DG	19838193, 19838195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30073579, 30770154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	30402506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	19838195	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	20849588, 22087647, 22694930, 22833143, 26606652, 29070082, 31804013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	30402506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	CTD_human_DG	19838193, 19838195		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	19838193, 19838195, 23740937, 26502338, 26606652, 27399966, 28714469, 30573655		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASDB_DG	19838193		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	19838195, 20516000, 20849588, 22087647, 22694930, 22833143, 23249952, 23858047, 23911423, 24023622, 26320362, 27659348, 29559739, 29589214, 29783072, 30341420, 30402506, 31033479 View all (3 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	ORPHANET_DG	19838195, 22087647, 22654485, 22833143, 23858047, 23917156		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus Nephritis	BEFREE	23970121, 29589214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	24386384	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	30402506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	27129285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	27129285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	16298037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23959881, 27621439, 30774867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	28454086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29765509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28693582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	16298037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	16298037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	16298037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	27744495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	27744495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	22190364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	23055271, 24361103		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myasthenia Gravis	Myasthenia Gravis	GWASDB_DG	23055271		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myasthenia Gravis	Myasthenia gravis	Pubtator	23055271, 34279044	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myositis	Myositis	GWASCAT_DG	30573655		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	23959881, 30213788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	20516000		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	27125519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	30213788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29765509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28693582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	LHGDN	19169254		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	CTD_human_DG	19169254, 20953190		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	19169254, 22298274, 22694930, 25574825, 27364786, 30543901	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	19446472, 20480402, 20875338, 20953187, 21339218, 21362769, 22542476, 23541940, 25182136, 25264125, 25481369, 25574825, 25789703, 26046540, 26738398, 27364786, 30402506, 31020648 View all (3 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	GWASDB_DG	20953187, 23143594		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	GWASCAT_DG	23143594, 25574825, 25854761, 26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	22170493, 23252691, 30341420		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis vulgaris	Psoriasis vulgaris	GWASCAT_DG	26626624, 29031612		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pustular psoriasis	Pustular Psoriasis	BEFREE	27364786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pustulosis of Palms and Soles	Palmoplantar Pustules	CTD_human_DG	19169254, 20953190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31819484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	12965196, 20849588, 21362769, 22542476		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASCAT_DG	30573655		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma	Scleroderma	BEFREE	30402506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	22694930, 32977850	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	CTD_human_DG	24097067		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sjogren's Syndrome	Sjogren syndrome	Pubtator	23944604, 24097067, 29070082	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sjogren`s Syndrome	Sjogren`s Syndrome	CTD_human_DG	24097067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren`s Syndrome	Sjogren`s Syndrome	GWASCAT_DG	24097067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	BEFREE	27125519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27250029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27250029, 30114685, 32502020	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32502020	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic lupus erythematosus	Systemic lupus erythematosus	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic Scleroderma	Scleroderma	BEFREE	21750679, 22694930, 22896740, 30402506		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic Scleroderma	Scleroderma	CTD_human_DG	21750679		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic Scleroderma	Scleroderma	GWASCAT_DG	21750679, 23740937, 30573655, 31672989		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic Scleroderma	Scleroderma	GWASDB_DG	21750679, 23740937		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	24788730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic syndrome	Pubtator	24788730	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	20516000		★★★★★ ★☆☆☆☆ Found in Text Mining only

TNIP1 (TNFAIP3 interacting protein 1)