Gene Gene information from NCBI Gene database.
Entrez ID 10300
Gene name Katanin regulatory subunit B1
Gene symbol KATNB1
Synonyms (NCBI Gene)
KATLIS6
Chromosome 16
Chromosome location 16q21
Summary Microtubules, polymers of alpha and beta tubulin subunits, form the mitotic spindle of a dividing cell and help to organize membranous organelles during interphase. Katanin is a heterodimer that consists of a 60 kDa ATPase (p60 subunit A 1) and an 80 kDa
SNPs SNP information provided by dbSNP.
5
SNP ID Visualize variation Clinical significance Consequence
rs730880257 C>T Pathogenic Missense variant, coding sequence variant
rs730880258 T>G Pathogenic Missense variant, coding sequence variant
rs730880259 G>A,T Pathogenic Missense variant, coding sequence variant
rs879255517 C>- Pathogenic Frameshift variant, coding sequence variant
rs879255519 G>A Pathogenic Splice donor variant
miRNA miRNA information provided by mirtarbase database.
105
miRTarBase ID miRNA Experiments Reference
MIRT051547 hsa-let-7e-5p CLASH 23622248
MIRT050360 hsa-miR-25-3p CLASH 23622248
MIRT043768 hsa-miR-328-3p CLASH 23622248
MIRT1079225 hsa-miR-15a CLIP-seq
MIRT1079226 hsa-miR-15b CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
44
GO ID Ontology Definition Evidence Reference
GO:0000922 Component Spindle pole IDA 10751153, 26929214
GO:0000922 Component Spindle pole IEA
GO:0005515 Function Protein binding IPI 24486153, 26496610, 26929214, 28514442, 32814053, 33961781
GO:0005634 Component Nucleus HDA 21630459
GO:0005737 Component Cytoplasm IDA 10751153, 26929214
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602703 6217 ENSG00000140854
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BVA0
Protein name Katanin p80 WD40 repeat-containing subunit B1 (Katanin p80 subunit B1) (p80 katanin)
Protein function Participates in a complex which severs microtubules in an ATP-dependent manner. May act to target the enzymatic subunit of this complex to sites of action such as the centrosome. Microtubule severing may promote rapid reorganization of cellular
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00400 WD40 10 49 WD domain, G-beta repeat Repeat
PF00400 WD40 53 91 WD domain, G-beta repeat Repeat
PF00400 WD40 95 133 WD domain, G-beta repeat Repeat
PF00400 WD40 137 175 WD domain, G-beta repeat Repeat
PF00400 WD40 179 217 WD domain, G-beta repeat Repeat
PF13925 Katanin_con80 493 651 con80 domain of Katanin Domain
Sequence
MATPVVTKTAWKLQEIVAHASNVSSLVLGKASGRLLATGGDDCRVNLWSINKPNCIMSLT
GHTSPVESVRLNTPEELIVAGSQSGSIRVWD
LEAAKILRTLMGHKANICSLDFHPYGEFV
ASGSQDTNIKLWD
IRRKGCVFRYRGHSQAVRCLRFSPDGKWLASAADDHTVKLWDLTAGK
MMSEFPGHTGPVNVVEFHPNEYLLASGSSDRTIRFWD
LEKFQVVSCIEGEPGPVRSVLFN
PDGCCLYSGCQDSLRVYGWEPERCFDVVLVNWGKVADLAICNDQLIGVAFSQSNVSSYVV
DLTRVTRTGTVARDPVQDHRPLAQPLPNPSAPLRRIYERPSTTCSKPQRVKQNSESERRS
PSSEDDRDERESRAEIQNAEDYNEIFQPKNSISRTPPRRSEPFPAPPEDDAATAKEAAKP
SPAMDVQFPVPNLEVLPRPPVVASTPAPKAEPAIIPATRNEPIGLKASDFLPAVKIPQQA
ELVDEDAMSQIRKGHDTMCVVLTSRHKNLDTVRAVWTMGDIKTSVDSAVAINDLSVVVDL
LNIVNQKASLWKLDLCTTVLPQIEKLLQSKYESYVQTGCTSLKLILQRFLPLITDMLAAP
PSVGVDISREERLHKCRLCYKQLKSISGLVKSKSGLSGRHGSTFRELHLLM
ASLD
Sequence length 655
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
19
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Familial cancer of breast Likely pathogenic rs376558334 RCV005922464
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
KATNB1-related disorder Likely pathogenic rs376558334, rs2506910748 RCV003401713
RCV003393185
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Lissencephaly 6 with microcephaly Likely pathogenic; Pathogenic rs376558334, rs730880257, rs730880258, rs879255517, rs879255518, rs730880259, rs879255519 RCV001782327
RCV000157597
RCV000157598
RCV000157599
RCV000157600
View all (2 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cervical cancer Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Alzheimer Disease Alzheimer disease Pubtator 23894477 Associate
★☆☆☆☆
Found in Text Mining only
Anaplastic thyroid carcinoma Anaplastic thyroid cancer BEFREE 19825993, 9177396
★☆☆☆☆
Found in Text Mining only
Aortic Aneurysm Abdominal Aortic aneurysm Pubtator 26767057 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Carcinoma BEFREE 9177396
★☆☆☆☆
Found in Text Mining only
Colon Carcinoma Colon Carcinoma BEFREE 29632619
★☆☆☆☆
Found in Text Mining only
Congenital anomaly of brain Brain malformation BEFREE 26640080
★☆☆☆☆
Found in Text Mining only
Congenital Heart Defects Congenital heart defects BEFREE 28791777
★☆☆☆☆
Found in Text Mining only
Congenital microcephaly Congenital Microcephaly BEFREE 26640080
★☆☆☆☆
Found in Text Mining only
Diffuse Cerebral Sclerosis of Schilder Schilder disease Pubtator 31484711 Associate
★☆☆☆☆
Found in Text Mining only
Dwarfism Dwarfism BEFREE 26640080
★☆☆☆☆
Found in Text Mining only