Gene Gene information from NCBI Gene database.
Entrez ID 10298
Gene name P21 (RAC1) activated kinase 4
Gene symbol PAK4
Synonyms (NCBI Gene)
-
Chromosome 19
Chromosome location 19q13.2
Summary PAK proteins, a family of serine/threonine p21-activating kinases, include PAK1, PAK2, PAK3 and PAK4. PAK proteins are critical effectors that link Rho GTPases to cytoskeleton reorganization and nuclear signaling. They serve as targets for the small GTP b
miRNA miRNA information provided by mirtarbase database.
439
miRTarBase ID miRNA Experiments Reference
MIRT006899 hsa-miR-145-5p Luciferase reporter assayqRT-PCRWestern blot 22766504
MIRT030445 hsa-miR-24-3p Microarray 19748357
MIRT030445 hsa-miR-24-3p Luciferase reporter assay 23071155
MIRT030445 hsa-miR-24-3p Luciferase reporter assay 23071155
MIRT051766 hsa-let-7c-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
37
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0001558 Process Regulation of cell growth TAS 20070256
GO:0004672 Function Protein kinase activity IEA
GO:0004672 Function Protein kinase activity NAS 9822598
GO:0004674 Function Protein serine/threonine kinase activity IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605451 16059 ENSG00000130669
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O96013
Protein name Serine/threonine-protein kinase PAK 4 (EC 2.7.11.1) (p21-activated kinase 4) (PAK-4)
Protein function Serine/threonine-protein kinase that plays a role in a variety of different signaling pathways including cytoskeleton regulation, cell adhesion turnover, cell migration, growth, proliferation or cell survival (PubMed:26598620). Activation by var
PDB 2BVA , 2CDZ , 2J0I , 2OV2 , 2Q0N , 2X4Z , 4APP , 4FIE , 4FIF , 4FIG , 4FIH , 4FII , 4FIJ , 4JDH , 4JDI , 4JDJ , 4JDK , 4L67 , 4NJD , 4O0V , 4O0X , 4O0Y , 4XBR , 4XBU , 5BMS , 5I0B , 5UPK , 5UPL , 5VED , 5VEE , 5VEF , 5XVA , 5XVF , 5XVG , 5ZJW , 6WLX , 6WLY , 7CMB , 7CP3 , 7CP4 , 7S46 , 7S47 , 7S48 , 8AHG , 8AHH , 8AHI , 8YHK
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00786 PBD 10 65 P21-Rho-binding domain Domain
PF00069 Pkinase 321 572 Protein kinase domain Domain
Tissue specificity TISSUE SPECIFICITY: Highest expression in prostate, testis and colon.
Sequence
MFGKRKKRVEISAPSNFEHRVHTGFDQHEQKFTGLPRQWQSLIEESARRPKPLVDPACIT
SIQPG
APKTIVRGSKGAKDGALTLLLDEFENMSVTRSNSLRRDSPPPPARARQENGMPEE
PATTARGGPGKAGSRGRFAGHSEAGGGSGDRRRAGPEKRPKSSREGSGGPQESSRDKRPL
SGPDVGTPQPAGLASGAKLAAGRPFNTYPRADTDHPSRGAQGEPHDVAPNGPSAGGLAIP
QSSSSSSRPPTRARGAPSPGVLGPHASEPQLAPPACTPAAPAVPGPPGPRSPQREPQRVS
HEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRR
ELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAV
CLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPY
WMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHK
VSPSLKGFLDRLLVRDPAQRATAAELLKHPFL
AKAGPPASIVPLMRQNRTR
Sequence length 591
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  ErbB signaling pathway
Ras signaling pathway
Axon guidance
Focal adhesion
T cell receptor signaling pathway
Regulation of actin cytoskeleton
Human immunodeficiency virus 1 infection
MicroRNAs in cancer
Renal cell carcinoma
 
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
4
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ALZHEIMER DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Hereditary breast ovarian cancer syndrome Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
NEUROBLASTOMA CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Prostate cancer Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma Adenocarcinoma BEFREE 28556956
★☆☆☆☆
Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA Syndromic microphthalmia BEFREE 19050074, 27845911, 28062705
★☆☆☆☆
Found in Text Mining only
Anophthalmia with pulmonary hypoplasia Anophthalmia Pubtator 28205613 Associate
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 20697354, 23873832, 28407679, 29055713, 30177834, 30808546, 31121213, 31399573, 31594963
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 23873832, 26399456, 26554417, 26598620, 27297086, 31121213, 31987914 Associate
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 16227624, 27077843, 29440672 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Embryonal Embryonal carcinoma Pubtator 30683686 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 21316602 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma of lung Lung carcinoma BEFREE 24366569, 25975262, 30683654
★☆☆☆☆
Found in Text Mining only
Carcinoma Renal Cell Renal cell carcinoma Pubtator 34085786 Associate
★☆☆☆☆
Found in Text Mining only