Gene Gene information from NCBI Gene database.
Entrez ID 10294
Gene name DnaJ heat shock protein family (Hsp40) member A2
Gene symbol DNAJA2
Synonyms (NCBI Gene)
CPR3DJ3DJA2DNAJDNJ3HIRIP4PRO3015RDJ2
Chromosome 16
Chromosome location 16q11.2
Summary The protein encoded by this gene belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid
miRNA miRNA information provided by mirtarbase database.
434
miRTarBase ID miRNA Experiments Reference
MIRT028942 hsa-miR-26b-5p Microarray 19088304
MIRT031115 hsa-miR-19b-3p Sequencing 20371350
MIRT031498 hsa-miR-16-5p Proteomics 18668040
MIRT039924 hsa-miR-615-3p CLASH 23622248
MIRT558357 hsa-miR-4426 PAR-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
24
GO ID Ontology Definition Evidence Reference
GO:0001671 Function ATPase activator activity IDA 24318877
GO:0001671 Function ATPase activator activity IEA
GO:0005515 Function Protein binding IPI 22085931, 25036637, 32296183, 33961781
GO:0005524 Function ATP binding IEA
GO:0005737 Component Cytoplasm IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
611322 14884 ENSG00000069345
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O60884
Protein name DnaJ homolog subfamily A member 2 (Cell cycle progression restoration gene 3 protein) (Dnj3) (Dj3) (HIRA-interacting protein 4) (Renal carcinoma antigen NY-REN-14)
Protein function Co-chaperone of Hsc70. Stimulates ATP hydrolysis and the folding of unfolded proteins mediated by HSPA1A/B (in vitro) (PubMed:24318877).
PDB 7ZHS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00226 DnaJ 8 67 DnaJ domain Domain
PF01556 DnaJ_C 116 338 DnaJ C terminal domain Domain
PF00684 DnaJ_CXXCXGXG 143 209 DnaJ central domain Domain
Sequence
MANVADTKLYDILGVPPGASENELKKAYRKLAKEYHPDKNPNAGDKFKEISFAYEVLSNP
EKRELYD
RYGEQGLREGSGGGGGMDDIFSHIFGGGLFGFMGNQSRSRNGRRRGEDMMHPL
KVSLEDLYNGKTTKLQLSKNVL
CSACSGQGGKSGAVQKCSACRGRGVRIMIRQLAPGMVQ
QMQSVCSDCNGEGEVINEKDRCKKCEGKK
VIKEVKILEVHVDKGMKHGQRITFTGEADQA
PGVEPGDIVLLLQEKEHEVFQRDGNDLHMTYKIGLVEALCGFQFTFKHLDGRQIVVKYPP
GKVIEPGCVRVVRGEGMPQYRNPFEKGDLYIKFDVQFP
ENNWINPDKLSELEDLLPSRPE
VPNIIGETEEVELQEFDSTRGSGGGQRREAYNDSSDEESSSHHGPGVQCAHQ
Sequence length 412
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Protein processing in endoplasmic reticulum   HSP90 chaperone cycle for steroid hormone receptors (SHR)
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ALZHEIMER DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Aicardi Goutieres syndrome Aicardi goutieres syndrome Pubtator 19016741 Associate
★☆☆☆☆
Found in Text Mining only
Arthritis Rheumatoid Rheumatoid arthritis Pubtator 23408083 Associate
★☆☆☆☆
Found in Text Mining only
Brain Infarction Brain infarction Pubtator 39735968 Associate
★☆☆☆☆
Found in Text Mining only
Cerebral Infarction Ischemic stroke Pubtator 39735968 Associate
★☆☆☆☆
Found in Text Mining only
Cushing Syndrome Cushing syndrome Pubtator 25605907 Associate
★☆☆☆☆
Found in Text Mining only
Fibrolamellar Hepatocellular Carcinoma Hepatocellular Carcinoma BEFREE 31063128
★☆☆☆☆
Found in Text Mining only
Huntington Disease Huntington Disease BEFREE 22396390
★☆☆☆☆
Found in Text Mining only
Lupus Erythematosus Systemic Systemic lupus erythematosus Pubtator 21437871 Associate
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of stomach Stomach Neoplasms BEFREE 28481734
★☆☆☆☆
Found in Text Mining only
Neoplasms Neoplasms BEFREE 15601829, 21106534, 24578576, 28481734
★☆☆☆☆
Found in Text Mining only