Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10287
Gene name	Regulator of G protein signaling 19
Gene symbol	RGS19
Synonyms (NCBI Gene)	GAIPRGSGAIP
Chromosome	20
Chromosome location	20q13.33
Summary	G proteins mediate a number of cellular processes. The protein encoded by this gene belongs to the RGS (regulators of G-protein signaling) family and specifically interacts with G protein, GAI3. This protein is a guanosine triphosphatase-activating protei

141

Show/Hide all (141)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027736	hsa-miR-98-5p	Microarray	19088304
MIRT045892	hsa-miR-125b-5p	CLASH	23622248
MIRT570992	hsa-miR-4695-5p	PAR-CLIP	20371350
MIRT570991	hsa-miR-4667-5p	PAR-CLIP	20371350
MIRT570990	hsa-miR-4700-5p	PAR-CLIP	20371350
MIRT570988	hsa-miR-8089	PAR-CLIP	20371350
MIRT570989	hsa-miR-5008-5p	PAR-CLIP	20371350
MIRT570987	hsa-miR-2467-5p	PAR-CLIP	20371350
MIRT570986	hsa-miR-6847-3p	PAR-CLIP	20371350
MIRT570985	hsa-miR-765	PAR-CLIP	20371350
MIRT570984	hsa-miR-874-5p	PAR-CLIP	20371350
MIRT570983	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT570982	hsa-miR-3175	PAR-CLIP	20371350
MIRT570981	hsa-miR-1343-5p	PAR-CLIP	20371350
MIRT570980	hsa-miR-939-5p	PAR-CLIP	20371350
MIRT570978	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT570979	hsa-miR-3150a-3p	PAR-CLIP	20371350
MIRT570977	hsa-miR-6763-5p	PAR-CLIP	20371350
MIRT570976	hsa-miR-7107-5p	PAR-CLIP	20371350
MIRT570981	hsa-miR-1343-5p	PAR-CLIP	26701625
MIRT570981	hsa-miR-1343-5p	PAR-CLIP	26701625
MIRT570987	hsa-miR-2467-5p	PAR-CLIP	26701625
MIRT570987	hsa-miR-2467-5p	PAR-CLIP	26701625
MIRT570979	hsa-miR-3150a-3p	PAR-CLIP	26701625
MIRT570979	hsa-miR-3150a-3p	PAR-CLIP	26701625
MIRT570982	hsa-miR-3175	PAR-CLIP	26701625
MIRT570982	hsa-miR-3175	PAR-CLIP	26701625
MIRT570991	hsa-miR-4667-5p	PAR-CLIP	26701625
MIRT570991	hsa-miR-4667-5p	PAR-CLIP	26701625
MIRT570992	hsa-miR-4695-5p	PAR-CLIP	26701625
MIRT570992	hsa-miR-4695-5p	PAR-CLIP	26701625
MIRT570990	hsa-miR-4700-5p	PAR-CLIP	26701625
MIRT570990	hsa-miR-4700-5p	PAR-CLIP	26701625
MIRT570989	hsa-miR-5008-5p	PAR-CLIP	26701625
MIRT570989	hsa-miR-5008-5p	PAR-CLIP	26701625
MIRT570977	hsa-miR-6763-5p	PAR-CLIP	26701625
MIRT570977	hsa-miR-6763-5p	PAR-CLIP	26701625
MIRT570978	hsa-miR-6825-5p	PAR-CLIP	26701625
MIRT570978	hsa-miR-6825-5p	PAR-CLIP	26701625
MIRT570986	hsa-miR-6847-3p	PAR-CLIP	26701625
MIRT570986	hsa-miR-6847-3p	PAR-CLIP	26701625
MIRT570983	hsa-miR-7106-5p	PAR-CLIP	26701625
MIRT570983	hsa-miR-7106-5p	PAR-CLIP	26701625
MIRT570976	hsa-miR-7107-5p	PAR-CLIP	26701625
MIRT570976	hsa-miR-7107-5p	PAR-CLIP	26701625
MIRT570985	hsa-miR-765	PAR-CLIP	26701625
MIRT570985	hsa-miR-765	PAR-CLIP	26701625
MIRT570988	hsa-miR-8089	PAR-CLIP	26701625
MIRT570988	hsa-miR-8089	PAR-CLIP	26701625
MIRT570984	hsa-miR-874-5p	PAR-CLIP	26701625
MIRT570984	hsa-miR-874-5p	PAR-CLIP	26701625
MIRT570980	hsa-miR-939-5p	PAR-CLIP	26701625
MIRT570980	hsa-miR-939-5p	PAR-CLIP	26701625
MIRT570992	hsa-miR-4695-5p	PAR-CLIP	20371350
MIRT570991	hsa-miR-4667-5p	PAR-CLIP	20371350
MIRT570990	hsa-miR-4700-5p	PAR-CLIP	20371350
MIRT570988	hsa-miR-8089	PAR-CLIP	20371350
MIRT570989	hsa-miR-5008-5p	PAR-CLIP	20371350
MIRT570987	hsa-miR-2467-5p	PAR-CLIP	20371350
MIRT570986	hsa-miR-6847-3p	PAR-CLIP	20371350
MIRT570985	hsa-miR-765	PAR-CLIP	20371350
MIRT570984	hsa-miR-874-5p	PAR-CLIP	20371350
MIRT570983	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT570982	hsa-miR-3175	PAR-CLIP	20371350
MIRT570981	hsa-miR-1343-5p	PAR-CLIP	20371350
MIRT570980	hsa-miR-939-5p	PAR-CLIP	20371350
MIRT570978	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT570979	hsa-miR-3150a-3p	PAR-CLIP	20371350
MIRT570977	hsa-miR-6763-5p	PAR-CLIP	20371350
MIRT570976	hsa-miR-7107-5p	PAR-CLIP	20371350
MIRT1304277	hsa-miR-1323	CLIP-seq
MIRT1304278	hsa-miR-3074-5p	CLIP-seq
MIRT1304279	hsa-miR-3187-3p	CLIP-seq
MIRT1304280	hsa-miR-370	CLIP-seq
MIRT1304281	hsa-miR-4254	CLIP-seq
MIRT1304282	hsa-miR-4435	CLIP-seq
MIRT1304283	hsa-miR-4653-3p	CLIP-seq
MIRT1304284	hsa-miR-4701-5p	CLIP-seq
MIRT1304285	hsa-miR-4719	CLIP-seq
MIRT1304286	hsa-miR-548o	CLIP-seq
MIRT1304287	hsa-miR-548s	CLIP-seq
MIRT1304288	hsa-miR-588	CLIP-seq
MIRT1304289	hsa-miR-939	CLIP-seq
MIRT1304290	hsa-miR-1275	CLIP-seq
MIRT1304291	hsa-miR-3161	CLIP-seq
MIRT1304292	hsa-miR-3162-5p	CLIP-seq
MIRT1304293	hsa-miR-3976	CLIP-seq
MIRT1304294	hsa-miR-4517	CLIP-seq
MIRT1304295	hsa-miR-4665-5p	CLIP-seq
MIRT1304296	hsa-miR-570	CLIP-seq
MIRT1304297	hsa-miR-577	CLIP-seq
MIRT1304298	hsa-miR-628-3p	CLIP-seq
MIRT1304289	hsa-miR-939	CLIP-seq
MIRT1304289	hsa-miR-939	CLIP-seq
MIRT1304278	hsa-miR-3074-5p	CLIP-seq
MIRT1304279	hsa-miR-3187-3p	CLIP-seq
MIRT1304280	hsa-miR-370	CLIP-seq
MIRT1304281	hsa-miR-4254	CLIP-seq
MIRT1304282	hsa-miR-4435	CLIP-seq
MIRT1304283	hsa-miR-4653-3p	CLIP-seq
MIRT1304284	hsa-miR-4701-5p	CLIP-seq
MIRT1304287	hsa-miR-548s	CLIP-seq
MIRT1304288	hsa-miR-588	CLIP-seq
MIRT1304289	hsa-miR-939	CLIP-seq
MIRT2314902	hsa-miR-1286	CLIP-seq
MIRT1304277	hsa-miR-1323	CLIP-seq
MIRT1304278	hsa-miR-3074-5p	CLIP-seq
MIRT1304279	hsa-miR-3187-3p	CLIP-seq
MIRT1304280	hsa-miR-370	CLIP-seq
MIRT1304281	hsa-miR-4254	CLIP-seq
MIRT2314903	hsa-miR-4303	CLIP-seq
MIRT2314904	hsa-miR-4320	CLIP-seq
MIRT1304282	hsa-miR-4435	CLIP-seq
MIRT2314905	hsa-miR-4649-3p	CLIP-seq
MIRT1304283	hsa-miR-4653-3p	CLIP-seq
MIRT2314906	hsa-miR-4658	CLIP-seq
MIRT1304284	hsa-miR-4701-5p	CLIP-seq
MIRT1304285	hsa-miR-4719	CLIP-seq
MIRT2314907	hsa-miR-4722-5p	CLIP-seq
MIRT2314908	hsa-miR-4758-5p	CLIP-seq
MIRT1304286	hsa-miR-548o	CLIP-seq
MIRT1304287	hsa-miR-548s	CLIP-seq
MIRT1304288	hsa-miR-588	CLIP-seq
MIRT1304289	hsa-miR-939	CLIP-seq
MIRT1304278	hsa-miR-3074-5p	CLIP-seq
MIRT1304279	hsa-miR-3187-3p	CLIP-seq
MIRT1304280	hsa-miR-370	CLIP-seq
MIRT1304281	hsa-miR-4254	CLIP-seq
MIRT1304282	hsa-miR-4435	CLIP-seq
MIRT1304283	hsa-miR-4653-3p	CLIP-seq
MIRT1304284	hsa-miR-4701-5p	CLIP-seq
MIRT1304287	hsa-miR-548s	CLIP-seq
MIRT1304288	hsa-miR-588	CLIP-seq
MIRT1304289	hsa-miR-939	CLIP-seq
MIRT2458136	hsa-miR-1254	CLIP-seq
MIRT2458137	hsa-miR-3116	CLIP-seq
MIRT2458138	hsa-miR-604	CLIP-seq
MIRT2458139	hsa-miR-637	CLIP-seq
MIRT2458140	hsa-miR-647	CLIP-seq
MIRT2458141	hsa-miR-661	CLIP-seq
MIRT1304289	hsa-miR-939	CLIP-seq

Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS
GO:0005515	Function	Protein binding	IPI	8524874, 9770488, 32296183, 34685729
GO:0005794	Component	Golgi apparatus	TAS	9571244
GO:0005886	Component	Plasma membrane	TAS
GO:0006914	Process	Autophagy	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	8524874
GO:0007264	Process	Small GTPase-mediated signal transduction	TAS	9571244
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9571244

MIM	HGNC	e!Ensembl
605071	13735	ENSG00000171700

P49795

Protein name

Regulator of G-protein signaling 19 (RGS19) (G-alpha-interacting protein) (GAIP)

Protein function

Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to G-alpha subfamily 1 members, with the order G(i)a3 > G(i)a1 > G(o)a >> G(z)a/G(i)a2. Act

PDB

1CMZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00615	RGS	90 → 205	Regulator of G protein signaling domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highest expression in lung. Placenta, liver and heart also express high levels of GAIP.

Sequence

MPTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSWNQERRRAWQ
ASRESKLQPLPSCEVCATPSPEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFW
LACEELKAEANQHVVDEKARLIYEDYVSILSPKEVSLDSRVREGINKKMQEPSAHTFDDA
QLQIYTLMHRDSYPRFLSSPTYRALLLQGPSQSSSEA

Sequence length

217

Interactions

View interactions

	Reactome
			G alpha (q) signalling events G alpha (i) signalling events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEPTIC ULCER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (10)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	17079444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	9882627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10993892	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	9882627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	35168826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23911936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33845140	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	32264916	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34482807	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	35406685	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RGS19 (regulator of G protein signaling 19)