Gene Gene information from NCBI Gene database.
Entrez ID 10285
Gene name Survival motor neuron domain containing 1
Gene symbol SMNDC1
Synonyms (NCBI Gene)
SMNRSPF30TDRD16C
Chromosome 10
Chromosome location 10q25.2
Summary This gene is a paralog of SMN1 gene, which encodes the survival motor neuron protein, mutations in which are cause of autosomal recessive proximal spinal muscular atrophy. The protein encoded by this gene is a nuclear protein that has been identified as a
miRNA miRNA information provided by mirtarbase database.
180
miRTarBase ID miRNA Experiments Reference
MIRT029377 hsa-miR-26b-5p Microarray 19088304
MIRT030868 hsa-miR-21-5p Sequencing 20371350
MIRT699135 hsa-miR-580-5p HITS-CLIP 23313552
MIRT699134 hsa-miR-3614-3p HITS-CLIP 23313552
MIRT699133 hsa-miR-6074 HITS-CLIP 23313552
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17
GO ID Ontology Definition Evidence Reference
GO:0000375 Process RNA splicing, via transesterification reactions IEA
GO:0000375 Process RNA splicing, via transesterification reactions TAS 9731529
GO:0003723 Function RNA binding HDA 22658674
GO:0003723 Function RNA binding IEA
GO:0005515 Function Protein binding IPI 15494309, 17332742, 22101937, 22365833, 33961781, 39251607
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603519 16900 ENSG00000119953
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O75940
Protein name Survival of motor neuron-related-splicing factor 30 (30 kDa splicing factor SMNrp) (SMN-related protein) (Survival motor neuron domain-containing protein 1)
Protein function Involved in spliceosome assembly.
PDB 4A4F , 4A4H , 8POI
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06003 SMN 59 196 Survival motor neuron protein (SMN) Family
Tissue specificity TISSUE SPECIFICITY: Detected at intermediate levels in skeletal muscle, and at low levels in heart and pancreas. {ECO:0000269|PubMed:9817934}.
Sequence
MSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLAS
SDSFASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLL
NLKPVEEGRKAKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQ
FNNRAYSKNKKGQVKR
SIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ
Sequence length 238
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Spliceosome   mRNA Splicing - Major Pathway
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
STROKE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 25690035 Associate
★☆☆☆☆
Found in Text Mining only
Ovarian Neoplasms Ovarian neoplasm Pubtator 24831101 Associate
★☆☆☆☆
Found in Text Mining only
Skin Neoplasms Skin Neoplasms BEFREE 27003466
★☆☆☆☆
Found in Text Mining only
Spinal Muscular Atrophy Spinal Muscular Atrophy BEFREE 22020225
★☆☆☆☆
Found in Text Mining only