Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	10279
Gene name	Serine protease 16
Gene symbol	PRSS16
Synonyms (NCBI Gene)	TSSP
Chromosome	6
Chromosome location	6p22.1
Summary	This gene encodes a serine protease expressed exclusively in the thymus. It is thought to play a role in the alternative antigen presenting pathway used by cortical thymic epithelial cells during the positive selection of T cells. The gene is found in the

128

Show/Hide all (128)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030266	hsa-miR-26b-5p	Microarray	19088304
MIRT570263	hsa-miR-28-5p	PAR-CLIP	20371350
MIRT570262	hsa-miR-3139	PAR-CLIP	20371350
MIRT570261	hsa-miR-708-5p	PAR-CLIP	20371350
MIRT570260	hsa-miR-4487	PAR-CLIP	20371350
MIRT570259	hsa-miR-3135b	PAR-CLIP	20371350
MIRT570258	hsa-miR-504-3p	PAR-CLIP	20371350
MIRT570257	hsa-miR-122-5p	PAR-CLIP	20371350
MIRT462249	hsa-miR-4311	PAR-CLIP	23592263
MIRT462250	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT462248	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT462247	hsa-miR-3125	PAR-CLIP	23592263
MIRT462246	hsa-miR-3916	PAR-CLIP	23592263
MIRT462245	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT462244	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT462243	hsa-miR-6077	PAR-CLIP	23592263
MIRT462242	hsa-miR-3153	PAR-CLIP	23592263
MIRT462241	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT462240	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT462239	hsa-miR-542-3p	PAR-CLIP	23592263
MIRT462238	hsa-miR-1236-5p	PAR-CLIP	23592263
MIRT462237	hsa-miR-5197-3p	PAR-CLIP	23592263
MIRT570263	hsa-miR-28-5p	PAR-CLIP	20371350
MIRT570262	hsa-miR-3139	PAR-CLIP	20371350
MIRT570261	hsa-miR-708-5p	PAR-CLIP	20371350
MIRT570260	hsa-miR-4487	PAR-CLIP	20371350
MIRT570259	hsa-miR-3135b	PAR-CLIP	20371350
MIRT570258	hsa-miR-504-3p	PAR-CLIP	20371350
MIRT570257	hsa-miR-122-5p	PAR-CLIP	20371350
MIRT462249	hsa-miR-4311	PAR-CLIP	23592263
MIRT462250	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT462248	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT462247	hsa-miR-3125	PAR-CLIP	23592263
MIRT462246	hsa-miR-3916	PAR-CLIP	23592263
MIRT462245	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT462244	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT462243	hsa-miR-6077	PAR-CLIP	23592263
MIRT462242	hsa-miR-3153	PAR-CLIP	23592263
MIRT462241	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT462240	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT462239	hsa-miR-542-3p	PAR-CLIP	23592263
MIRT462238	hsa-miR-1236-5p	PAR-CLIP	23592263
MIRT462237	hsa-miR-5197-3p	PAR-CLIP	23592263
MIRT1268383	hsa-miR-1197	CLIP-seq
MIRT1268384	hsa-miR-122	CLIP-seq
MIRT1268385	hsa-miR-1224-5p	CLIP-seq
MIRT1268386	hsa-miR-1253	CLIP-seq
MIRT1268387	hsa-miR-1266	CLIP-seq
MIRT1268388	hsa-miR-1273d	CLIP-seq
MIRT1268389	hsa-miR-185	CLIP-seq
MIRT1268390	hsa-miR-1909	CLIP-seq
MIRT1268391	hsa-miR-198	CLIP-seq
MIRT1268392	hsa-miR-214	CLIP-seq
MIRT1268393	hsa-miR-2278	CLIP-seq
MIRT1268394	hsa-miR-2467-3p	CLIP-seq
MIRT1268395	hsa-miR-3121-3p	CLIP-seq
MIRT1268396	hsa-miR-3126-5p	CLIP-seq
MIRT1268397	hsa-miR-3150b-3p	CLIP-seq
MIRT1268398	hsa-miR-3160-5p	CLIP-seq
MIRT1268399	hsa-miR-3169	CLIP-seq
MIRT1268400	hsa-miR-320e	CLIP-seq
MIRT1268401	hsa-miR-3619-5p	CLIP-seq
MIRT1268402	hsa-miR-3646	CLIP-seq
MIRT1268403	hsa-miR-375	CLIP-seq
MIRT1268404	hsa-miR-383	CLIP-seq
MIRT1268405	hsa-miR-3915	CLIP-seq
MIRT1268406	hsa-miR-3919	CLIP-seq
MIRT1268407	hsa-miR-3936	CLIP-seq
MIRT1268408	hsa-miR-3976	CLIP-seq
MIRT1268409	hsa-miR-3978	CLIP-seq
MIRT1268410	hsa-miR-4251	CLIP-seq
MIRT1268411	hsa-miR-4270	CLIP-seq
MIRT1268412	hsa-miR-4276	CLIP-seq
MIRT1268413	hsa-miR-4291	CLIP-seq
MIRT1268414	hsa-miR-4306	CLIP-seq
MIRT1268415	hsa-miR-4419a	CLIP-seq
MIRT1268416	hsa-miR-4441	CLIP-seq
MIRT1268417	hsa-miR-4509	CLIP-seq
MIRT1268418	hsa-miR-4510	CLIP-seq
MIRT1268419	hsa-miR-4518	CLIP-seq
MIRT1268420	hsa-miR-4519	CLIP-seq
MIRT1268421	hsa-miR-4644	CLIP-seq
MIRT1268422	hsa-miR-4689	CLIP-seq
MIRT1268423	hsa-miR-4699-5p	CLIP-seq
MIRT1268424	hsa-miR-4712-3p	CLIP-seq
MIRT1268425	hsa-miR-4738-3p	CLIP-seq
MIRT1268426	hsa-miR-4740-5p	CLIP-seq
MIRT1268427	hsa-miR-4744	CLIP-seq
MIRT1268428	hsa-miR-4751	CLIP-seq
MIRT1268429	hsa-miR-4756-3p	CLIP-seq
MIRT1268430	hsa-miR-4772-5p	CLIP-seq
MIRT1268431	hsa-miR-4784	CLIP-seq
MIRT1268432	hsa-miR-539	CLIP-seq
MIRT1268433	hsa-miR-571	CLIP-seq
MIRT1268434	hsa-miR-577	CLIP-seq
MIRT1268435	hsa-miR-591	CLIP-seq
MIRT1268436	hsa-miR-665	CLIP-seq
MIRT1268437	hsa-miR-671-5p	CLIP-seq
MIRT1268438	hsa-miR-708	CLIP-seq
MIRT1268439	hsa-miR-761	CLIP-seq
MIRT1268440	hsa-miR-922	CLIP-seq
MIRT2078859	hsa-miR-1323	CLIP-seq
MIRT1268391	hsa-miR-198	CLIP-seq
MIRT1268392	hsa-miR-214	CLIP-seq
MIRT1268398	hsa-miR-3160-5p	CLIP-seq
MIRT1268399	hsa-miR-3169	CLIP-seq
MIRT2078860	hsa-miR-3616-3p	CLIP-seq
MIRT1268401	hsa-miR-3619-5p	CLIP-seq
MIRT1268404	hsa-miR-383	CLIP-seq
MIRT1268411	hsa-miR-4270	CLIP-seq
MIRT1268413	hsa-miR-4291	CLIP-seq
MIRT1268416	hsa-miR-4441	CLIP-seq
MIRT2078861	hsa-miR-4452	CLIP-seq
MIRT2078862	hsa-miR-4649-5p	CLIP-seq
MIRT2078863	hsa-miR-4680-3p	CLIP-seq
MIRT1268426	hsa-miR-4740-5p	CLIP-seq
MIRT1268430	hsa-miR-4772-5p	CLIP-seq
MIRT2078864	hsa-miR-4778-3p	CLIP-seq
MIRT2078865	hsa-miR-548o	CLIP-seq
MIRT1268435	hsa-miR-591	CLIP-seq
MIRT2078866	hsa-miR-607	CLIP-seq
MIRT1268436	hsa-miR-665	CLIP-seq
MIRT1268439	hsa-miR-761	CLIP-seq
MIRT1268440	hsa-miR-922	CLIP-seq
MIRT2305130	hsa-miR-382	CLIP-seq
MIRT2305131	hsa-miR-4259	CLIP-seq
MIRT2305132	hsa-miR-4422	CLIP-seq
MIRT2305133	hsa-miR-4425	CLIP-seq

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005764	Component	Lysosome	IBA
GO:0005764	Component	Lysosome	IDA	10527559
GO:0005764	Component	Lysosome	IEA
GO:0005768	Component	Endosome	IBA
GO:0005768	Component	Endosome	IDA	10527559
GO:0005768	Component	Endosome	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	NAS	10527559
GO:0008239	Function	Dipeptidyl-peptidase activity	IBA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030163	Process	Protein catabolic process	NAS	10527559
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0070008	Function	Serine-type exopeptidase activity	IEA

MIM	HGNC	e!Ensembl
607169	9480	ENSG00000112812

Q9NQE7

Protein name

Thymus-specific serine protease (EC 3.4.-.-) (Serine protease 16)

Protein function

Protease that may play a role in T-cell development.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05577	Peptidase_S28	64 → 494	Serine carboxypeptidase S28	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed predominantly in cortical thymic epithelial cells.

Sequence

MAVWLAQWLGPLLLVSLWGLLAPASLLRRLGEHIQQFQESSAQGLGLSLGPGAAALPKVG
WLEQLLDPFNVSDRRSFLQRYWVNDQHWVGQDGPIFLHLGGEGSLGPGSVMRGHPAALAP
AWGALVISLEHRFYGLSIPAGGLEMAQLRFLSSRLALADVVSARLALSRLFNISSSSPWI
CFGGSYAGSLAAWARLKFPHLIFASVASSAPVRAVLDFSEYNDVVSRSLMSTAIGGSLEC
RAAVSVAFAEVERRLRSGGAAQAALRTELSACGPLGRAENQAELLGALQALVGGVVQYDG
QTGAPLSVRQLCGLLLGGGGNRSHSTPYCGLRRAVQIVLHSLGQKCLSFSRAETVAQLRS
TEPQLSGVGDRQWLYQTCTEFGFYVTCENPRCPFSQLPALPSQLDLCEQVFGLSALSVAQ
AVAQTNSYYGGQTPGANKVLFVNGDTDPWHVLSVTQALGSSESTLLIRTGSHCLDMAPER
PSDSPSLRLGRQNIFQQLQTWLKLAKESQIKGEV

Sequence length

514

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-MELANOMA SKIN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (14)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Autoimmune Diseases	Autoimmune Diseases	BEFREE	12140752, 12144812		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	LHGDN	12140752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36204642	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	17584581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	25543139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	12144812, 17584581, 19295542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	29061767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	15592422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25543139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	22384243, 22488895		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	22384243, 22488895		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	32626976	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Thymoma	BEFREE	15592422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	28639897	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PRSS16 (serine protease 16)