Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	10270
Gene name	A-kinase anchoring protein 8
Gene symbol	AKAP8
Synonyms (NCBI Gene)	AKAP 95AKAP-8AKAP-95AKAP95
Chromosome	19
Chromosome location	19p13.12
Summary	This gene encodes a member of the A-kinase anchor protein family. A-kinase anchor proteins are scaffold proteins that contain a binding domain for the RI/RII subunit of protein kinase A (PKA) and recruit PKA and other signaling molecules to specific subce

294

Show/Hide all (294)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001654	hsa-let-7b-5p	pSILAC	18668040
MIRT024227	hsa-miR-218-5p	Sequencing	20371350
MIRT032126	hsa-let-7d-5p	Sequencing	20371350
MIRT001654	hsa-let-7b-5p	Proteomics;Other	18668040
MIRT040654	hsa-miR-92b-3p	CLASH	23622248
MIRT551923	hsa-miR-5683	HITS-CLIP	21572407
MIRT518817	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT518816	hsa-miR-656-3p	HITS-CLIP	21572407
MIRT518815	hsa-miR-6504-3p	HITS-CLIP	21572407
MIRT518811	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT518809	hsa-miR-6083	HITS-CLIP	21572407
MIRT518808	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT551941	hsa-miR-1252-3p	PAR-CLIP	20371350
MIRT551939	hsa-miR-3925-5p	PAR-CLIP	20371350
MIRT551940	hsa-miR-3123	PAR-CLIP	20371350
MIRT551938	hsa-miR-4719	PAR-CLIP	20371350
MIRT551937	hsa-miR-146a-5p	PAR-CLIP	20371350
MIRT551936	hsa-miR-146b-5p	PAR-CLIP	20371350
MIRT551935	hsa-miR-7153-5p	PAR-CLIP	20371350
MIRT551934	hsa-let-7a-5p	PAR-CLIP	20371350
MIRT001654	hsa-let-7b-5p	PAR-CLIP	20371350
MIRT551933	hsa-let-7c-5p	PAR-CLIP	20371350
MIRT032126	hsa-let-7d-5p	PAR-CLIP	20371350
MIRT551932	hsa-let-7e-5p	PAR-CLIP	20371350
MIRT551931	hsa-let-7f-5p	PAR-CLIP	20371350
MIRT551930	hsa-let-7g-5p	PAR-CLIP	20371350
MIRT551929	hsa-let-7i-5p	PAR-CLIP	20371350
MIRT551927	hsa-miR-4458	PAR-CLIP	20371350
MIRT551928	hsa-miR-4500	PAR-CLIP	20371350
MIRT551926	hsa-miR-98-5p	PAR-CLIP	20371350
MIRT551925	hsa-miR-202-3p	PAR-CLIP	20371350
MIRT551924	hsa-miR-1303	PAR-CLIP	20371350
MIRT551941	hsa-miR-1252-3p	PAR-CLIP	21572407
MIRT551939	hsa-miR-3925-5p	PAR-CLIP	21572407
MIRT551940	hsa-miR-3123	PAR-CLIP	21572407
MIRT551938	hsa-miR-4719	PAR-CLIP	21572407
MIRT551937	hsa-miR-146a-5p	PAR-CLIP	21572407
MIRT551936	hsa-miR-146b-5p	PAR-CLIP	21572407
MIRT551935	hsa-miR-7153-5p	PAR-CLIP	21572407
MIRT551934	hsa-let-7a-5p	PAR-CLIP	21572407
MIRT001654	hsa-let-7b-5p	PAR-CLIP	21572407
MIRT551933	hsa-let-7c-5p	PAR-CLIP	21572407
MIRT032126	hsa-let-7d-5p	PAR-CLIP	21572407
MIRT551932	hsa-let-7e-5p	PAR-CLIP	21572407
MIRT551931	hsa-let-7f-5p	PAR-CLIP	21572407
MIRT551930	hsa-let-7g-5p	PAR-CLIP	21572407
MIRT551929	hsa-let-7i-5p	PAR-CLIP	21572407
MIRT551927	hsa-miR-4458	PAR-CLIP	21572407
MIRT551928	hsa-miR-4500	PAR-CLIP	21572407
MIRT551926	hsa-miR-98-5p	PAR-CLIP	21572407
MIRT551925	hsa-miR-202-3p	PAR-CLIP	21572407
MIRT551924	hsa-miR-1303	PAR-CLIP	21572407
MIRT551923	hsa-miR-5683	PAR-CLIP	21572407
MIRT518817	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT518816	hsa-miR-656-3p	PAR-CLIP	21572407
MIRT518815	hsa-miR-6504-3p	PAR-CLIP	21572407
MIRT518814	hsa-miR-205-3p	PAR-CLIP	21572407
MIRT518813	hsa-miR-1250-3p	PAR-CLIP	21572407
MIRT518812	hsa-miR-153-5p	PAR-CLIP	21572407
MIRT518811	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT518810	hsa-miR-5696	PAR-CLIP	21572407
MIRT291883	hsa-miR-579-3p	PAR-CLIP	21572407
MIRT291887	hsa-miR-664b-3p	PAR-CLIP	21572407
MIRT518809	hsa-miR-6083	PAR-CLIP	21572407
MIRT518808	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT518817	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT518816	hsa-miR-656-3p	PAR-CLIP	23446348
MIRT518815	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT518814	hsa-miR-205-3p	PAR-CLIP	23446348
MIRT518813	hsa-miR-1250-3p	PAR-CLIP	23446348
MIRT518812	hsa-miR-153-5p	PAR-CLIP	23446348
MIRT518811	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT518810	hsa-miR-5696	PAR-CLIP	23446348
MIRT291883	hsa-miR-579-3p	PAR-CLIP	23446348
MIRT291887	hsa-miR-664b-3p	PAR-CLIP	23446348
MIRT518809	hsa-miR-6083	PAR-CLIP	23446348
MIRT518808	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT551923	hsa-miR-5683	HITS-CLIP	21572407
MIRT518817	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT518816	hsa-miR-656-3p	HITS-CLIP	21572407
MIRT518815	hsa-miR-6504-3p	HITS-CLIP	21572407
MIRT518811	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT518809	hsa-miR-6083	HITS-CLIP	21572407
MIRT518808	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT551941	hsa-miR-1252-3p	PAR-CLIP	20371350
MIRT551939	hsa-miR-3925-5p	PAR-CLIP	20371350
MIRT551940	hsa-miR-3123	PAR-CLIP	20371350
MIRT551938	hsa-miR-4719	PAR-CLIP	20371350
MIRT551937	hsa-miR-146a-5p	PAR-CLIP	20371350
MIRT551936	hsa-miR-146b-5p	PAR-CLIP	20371350
MIRT551935	hsa-miR-7153-5p	PAR-CLIP	20371350
MIRT551934	hsa-let-7a-5p	PAR-CLIP	20371350
MIRT001654	hsa-let-7b-5p	PAR-CLIP	20371350
MIRT551933	hsa-let-7c-5p	PAR-CLIP	20371350
MIRT032126	hsa-let-7d-5p	PAR-CLIP	20371350
MIRT551932	hsa-let-7e-5p	PAR-CLIP	20371350
MIRT551931	hsa-let-7f-5p	PAR-CLIP	20371350
MIRT551930	hsa-let-7g-5p	PAR-CLIP	20371350
MIRT551929	hsa-let-7i-5p	PAR-CLIP	20371350
MIRT551927	hsa-miR-4458	PAR-CLIP	20371350
MIRT551928	hsa-miR-4500	PAR-CLIP	20371350
MIRT551926	hsa-miR-98-5p	PAR-CLIP	20371350
MIRT551925	hsa-miR-202-3p	PAR-CLIP	20371350
MIRT551924	hsa-miR-1303	PAR-CLIP	20371350
MIRT551941	hsa-miR-1252-3p	PAR-CLIP	21572407
MIRT551939	hsa-miR-3925-5p	PAR-CLIP	21572407
MIRT551940	hsa-miR-3123	PAR-CLIP	21572407
MIRT551938	hsa-miR-4719	PAR-CLIP	21572407
MIRT551937	hsa-miR-146a-5p	PAR-CLIP	21572407
MIRT551936	hsa-miR-146b-5p	PAR-CLIP	21572407
MIRT551935	hsa-miR-7153-5p	PAR-CLIP	21572407
MIRT551934	hsa-let-7a-5p	PAR-CLIP	21572407
MIRT001654	hsa-let-7b-5p	PAR-CLIP	21572407
MIRT551933	hsa-let-7c-5p	PAR-CLIP	21572407
MIRT032126	hsa-let-7d-5p	PAR-CLIP	21572407
MIRT551932	hsa-let-7e-5p	PAR-CLIP	21572407
MIRT551931	hsa-let-7f-5p	PAR-CLIP	21572407
MIRT551930	hsa-let-7g-5p	PAR-CLIP	21572407
MIRT551929	hsa-let-7i-5p	PAR-CLIP	21572407
MIRT551927	hsa-miR-4458	PAR-CLIP	21572407
MIRT551928	hsa-miR-4500	PAR-CLIP	21572407
MIRT551926	hsa-miR-98-5p	PAR-CLIP	21572407
MIRT551925	hsa-miR-202-3p	PAR-CLIP	21572407
MIRT551924	hsa-miR-1303	PAR-CLIP	21572407
MIRT551923	hsa-miR-5683	PAR-CLIP	21572407
MIRT518817	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT518816	hsa-miR-656-3p	PAR-CLIP	21572407
MIRT518815	hsa-miR-6504-3p	PAR-CLIP	21572407
MIRT518814	hsa-miR-205-3p	PAR-CLIP	21572407
MIRT518813	hsa-miR-1250-3p	PAR-CLIP	21572407
MIRT518812	hsa-miR-153-5p	PAR-CLIP	21572407
MIRT518811	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT518810	hsa-miR-5696	PAR-CLIP	21572407
MIRT291883	hsa-miR-579-3p	PAR-CLIP	21572407
MIRT291887	hsa-miR-664b-3p	PAR-CLIP	21572407
MIRT518809	hsa-miR-6083	PAR-CLIP	21572407
MIRT518808	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT518817	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT518816	hsa-miR-656-3p	PAR-CLIP	23446348
MIRT518815	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT518814	hsa-miR-205-3p	PAR-CLIP	23446348
MIRT518813	hsa-miR-1250-3p	PAR-CLIP	23446348
MIRT518812	hsa-miR-153-5p	PAR-CLIP	23446348
MIRT518811	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT518810	hsa-miR-5696	PAR-CLIP	23446348
MIRT291883	hsa-miR-579-3p	PAR-CLIP	23446348
MIRT291887	hsa-miR-664b-3p	PAR-CLIP	23446348
MIRT518809	hsa-miR-6083	PAR-CLIP	23446348
MIRT518808	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT775963	hsa-miR-1273f	CLIP-seq
MIRT775964	hsa-miR-127-5p	CLIP-seq
MIRT775965	hsa-miR-1283	CLIP-seq
MIRT775966	hsa-miR-145	CLIP-seq
MIRT775967	hsa-miR-154	CLIP-seq
MIRT775968	hsa-miR-1825	CLIP-seq
MIRT775969	hsa-miR-183	CLIP-seq
MIRT775970	hsa-miR-193a-5p	CLIP-seq
MIRT775971	hsa-miR-199a-5p	CLIP-seq
MIRT775972	hsa-miR-199b-5p	CLIP-seq
MIRT775973	hsa-miR-3129-3p	CLIP-seq
MIRT775974	hsa-miR-3130-3p	CLIP-seq
MIRT775975	hsa-miR-3180-5p	CLIP-seq
MIRT775976	hsa-miR-3650	CLIP-seq
MIRT775977	hsa-miR-3658	CLIP-seq
MIRT775978	hsa-miR-3929	CLIP-seq
MIRT775979	hsa-miR-431	CLIP-seq
MIRT775980	hsa-miR-4419b	CLIP-seq
MIRT775981	hsa-miR-4455	CLIP-seq
MIRT775982	hsa-miR-4478	CLIP-seq
MIRT775983	hsa-miR-4484	CLIP-seq
MIRT775984	hsa-miR-4536	CLIP-seq
MIRT775985	hsa-miR-4705	CLIP-seq
MIRT775986	hsa-miR-4724-3p	CLIP-seq
MIRT775987	hsa-miR-4735-5p	CLIP-seq
MIRT775988	hsa-miR-4746-3p	CLIP-seq
MIRT775989	hsa-miR-4775	CLIP-seq
MIRT775990	hsa-miR-4781-3p	CLIP-seq
MIRT775991	hsa-miR-4793-3p	CLIP-seq
MIRT775992	hsa-miR-520d-5p	CLIP-seq
MIRT775993	hsa-miR-524-5p	CLIP-seq
MIRT775994	hsa-miR-526b	CLIP-seq
MIRT775995	hsa-miR-548an	CLIP-seq
MIRT775996	hsa-miR-548m	CLIP-seq
MIRT775997	hsa-miR-590-3p	CLIP-seq
MIRT775998	hsa-miR-609	CLIP-seq
MIRT775999	hsa-miR-615-5p	CLIP-seq
MIRT776000	hsa-miR-622	CLIP-seq
MIRT776001	hsa-miR-656	CLIP-seq
MIRT776002	hsa-miR-802	CLIP-seq
MIRT1928987	hsa-miR-1179	CLIP-seq
MIRT1928988	hsa-miR-1229	CLIP-seq
MIRT1928989	hsa-miR-1914	CLIP-seq
MIRT1928990	hsa-miR-197	CLIP-seq
MIRT1928991	hsa-miR-214	CLIP-seq
MIRT1928992	hsa-miR-3183	CLIP-seq
MIRT1928993	hsa-miR-331-5p	CLIP-seq
MIRT1928994	hsa-miR-3545-3p	CLIP-seq
MIRT1928995	hsa-miR-3619-5p	CLIP-seq
MIRT1928996	hsa-miR-378g	CLIP-seq
MIRT1928997	hsa-miR-3918	CLIP-seq
MIRT1928998	hsa-miR-4678	CLIP-seq
MIRT1928999	hsa-miR-4680-5p	CLIP-seq
MIRT1929000	hsa-miR-4720-3p	CLIP-seq
MIRT1929001	hsa-miR-4723-3p	CLIP-seq
MIRT1929002	hsa-miR-586	CLIP-seq
MIRT1929003	hsa-miR-607	CLIP-seq
MIRT1929004	hsa-miR-642b	CLIP-seq
MIRT1929005	hsa-miR-761	CLIP-seq
MIRT1928987	hsa-miR-1179	CLIP-seq
MIRT2169668	hsa-miR-1207-3p	CLIP-seq
MIRT2169669	hsa-miR-1249	CLIP-seq
MIRT2169670	hsa-miR-1267	CLIP-seq
MIRT775963	hsa-miR-1273f	CLIP-seq
MIRT775965	hsa-miR-1283	CLIP-seq
MIRT775970	hsa-miR-193a-5p	CLIP-seq
MIRT1928991	hsa-miR-214	CLIP-seq
MIRT2169671	hsa-miR-224	CLIP-seq
MIRT2169672	hsa-miR-3120-3p	CLIP-seq
MIRT775974	hsa-miR-3130-3p	CLIP-seq
MIRT2169673	hsa-miR-329	CLIP-seq
MIRT2169674	hsa-miR-335	CLIP-seq
MIRT2169675	hsa-miR-34b	CLIP-seq
MIRT1928995	hsa-miR-3619-5p	CLIP-seq
MIRT2169676	hsa-miR-362-3p	CLIP-seq
MIRT775977	hsa-miR-3658	CLIP-seq
MIRT2169677	hsa-miR-3677-5p	CLIP-seq
MIRT2169678	hsa-miR-3691-3p	CLIP-seq
MIRT2169679	hsa-miR-377	CLIP-seq
MIRT1928997	hsa-miR-3918	CLIP-seq
MIRT2169680	hsa-miR-3920	CLIP-seq
MIRT2169681	hsa-miR-4263	CLIP-seq
MIRT775979	hsa-miR-431	CLIP-seq
MIRT2169682	hsa-miR-4435	CLIP-seq
MIRT2169683	hsa-miR-4496	CLIP-seq
MIRT2169684	hsa-miR-4652-3p	CLIP-seq
MIRT2169685	hsa-miR-4717-5p	CLIP-seq
MIRT775986	hsa-miR-4724-3p	CLIP-seq
MIRT2169686	hsa-miR-4738-3p	CLIP-seq
MIRT2169687	hsa-miR-4760-5p	CLIP-seq
MIRT2169688	hsa-miR-4778-5p	CLIP-seq
MIRT775990	hsa-miR-4781-3p	CLIP-seq
MIRT775991	hsa-miR-4793-3p	CLIP-seq
MIRT2169689	hsa-miR-4795-3p	CLIP-seq
MIRT2169690	hsa-miR-519a	CLIP-seq
MIRT2169691	hsa-miR-519b-3p	CLIP-seq
MIRT2169692	hsa-miR-519c-3p	CLIP-seq
MIRT775992	hsa-miR-520d-5p	CLIP-seq
MIRT775993	hsa-miR-524-5p	CLIP-seq
MIRT775994	hsa-miR-526b	CLIP-seq
MIRT775996	hsa-miR-548m	CLIP-seq
MIRT2169693	hsa-miR-576-5p	CLIP-seq
MIRT2169694	hsa-miR-582-5p	CLIP-seq
MIRT1929003	hsa-miR-607	CLIP-seq
MIRT775999	hsa-miR-615-5p	CLIP-seq
MIRT776000	hsa-miR-622	CLIP-seq
MIRT1929004	hsa-miR-642b	CLIP-seq
MIRT2169695	hsa-miR-651	CLIP-seq
MIRT776001	hsa-miR-656	CLIP-seq
MIRT1929005	hsa-miR-761	CLIP-seq
MIRT2169670	hsa-miR-1267	CLIP-seq
MIRT1928991	hsa-miR-214	CLIP-seq
MIRT2472426	hsa-miR-3146	CLIP-seq
MIRT2472427	hsa-miR-3182	CLIP-seq
MIRT1928995	hsa-miR-3619-5p	CLIP-seq
MIRT1928997	hsa-miR-3918	CLIP-seq
MIRT2169680	hsa-miR-3920	CLIP-seq
MIRT2169683	hsa-miR-4496	CLIP-seq
MIRT2472428	hsa-miR-4643	CLIP-seq
MIRT2169684	hsa-miR-4652-3p	CLIP-seq
MIRT2472429	hsa-miR-4659a-3p	CLIP-seq
MIRT2472430	hsa-miR-4659b-3p	CLIP-seq
MIRT2472431	hsa-miR-4762-3p	CLIP-seq
MIRT2169688	hsa-miR-4778-5p	CLIP-seq
MIRT1929003	hsa-miR-607	CLIP-seq
MIRT2472432	hsa-miR-621	CLIP-seq
MIRT1929004	hsa-miR-642b	CLIP-seq
MIRT2169695	hsa-miR-651	CLIP-seq
MIRT1929005	hsa-miR-761	CLIP-seq
MIRT2169670	hsa-miR-1267	CLIP-seq
MIRT1928991	hsa-miR-214	CLIP-seq
MIRT2472427	hsa-miR-3182	CLIP-seq
MIRT1928995	hsa-miR-3619-5p	CLIP-seq
MIRT1928997	hsa-miR-3918	CLIP-seq
MIRT2169680	hsa-miR-3920	CLIP-seq
MIRT2169683	hsa-miR-4496	CLIP-seq
MIRT2169684	hsa-miR-4652-3p	CLIP-seq
MIRT2472429	hsa-miR-4659a-3p	CLIP-seq
MIRT2472430	hsa-miR-4659b-3p	CLIP-seq
MIRT2472431	hsa-miR-4762-3p	CLIP-seq
MIRT2169688	hsa-miR-4778-5p	CLIP-seq
MIRT1929003	hsa-miR-607	CLIP-seq
MIRT1929004	hsa-miR-642b	CLIP-seq
MIRT2169695	hsa-miR-651	CLIP-seq
MIRT1929005	hsa-miR-761	CLIP-seq

Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000278	Process	Mitotic cell cycle	TAS	9473338
GO:0000793	Component	Condensed chromosome	IEA
GO:0001939	Component	Female pronucleus	IEA
GO:0002376	Process	Immune system process	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0005515	Function	Protein binding	IPI	9473338, 12740381, 16227597, 16980585, 22130794, 23995757, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	9473338
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA	26683827
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0007076	Process	Mitotic chromosome condensation	IBA
GO:0007076	Process	Mitotic chromosome condensation	IEA
GO:0007165	Process	Signal transduction	TAS	9473338
GO:0008270	Function	Zinc ion binding	IEA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016363	Component	Nuclear matrix	IBA
GO:0016363	Component	Nuclear matrix	IEA
GO:0016363	Component	Nuclear matrix	ISS
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IEA
GO:0034237	Function	Protein kinase A regulatory subunit binding	IBA
GO:0034237	Function	Protein kinase A regulatory subunit binding	IEA
GO:0034237	Function	Protein kinase A regulatory subunit binding	IPI	17911601
GO:0042826	Function	Histone deacetylase binding	IDA	16980585
GO:0044839	Process	Cell cycle G2/M phase transition	IMP	16980585
GO:0045087	Process	Innate immune response	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051059	Function	NF-kappaB binding	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071380	Process	Cellular response to prostaglandin E stimulus	IEA

MIM	HGNC	e!Ensembl
604692	378	ENSG00000105127

O43823

Protein name

A-kinase anchor protein 8 (AKAP-8) (A-kinase anchor protein 95 kDa) (AKAP 95)

Protein function

Anchoring protein that mediates the subcellular compartmentation of cAMP-dependent protein kinase (PKA type II) (PubMed:9473338). Acts as an anchor for a PKA-signaling complex onto mitotic chromosomes, which is required for maintenance of chromo

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04988	AKAP95	415 → 546	A-kinase anchoring protein 95 (AKAP95)	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in heart, liver, skeletal muscle, kidney and pancreas. Expressed in mature dendritic cells. {ECO:0000269|PubMed:19277197}.

Sequence

MDQGYGGYGAWSAGPANTQGAYGTGVASWQGYENYNYYGAQNTSVTTGATYSYGPASWEA
AKANDGGLAAGAPAMHMASYGPEPCTDNSDSLIAKINQRLDMMSKEGGRGGSGGGGEGIQ
DRESSFRFQPFESYDSRPCLPEHNPYRPSYSYDYEFDLGSDRNGSFGGQYSECRDPARER
GSLDGFMRGRGQGRFQDRSNPGTFMRSDPFVPPAASSEPLSTPWNELNYVGGRGLGGPSP
SRPPPSLFSQSMAPDYGVMGMQGAGGYDSTMPYGCGRSQPRMRDRDRPKRRGFDRFGPDG
TGRKRKQFQLYEEPDTKLARVDSEGDFSENDDAAGDFRSGDEEFKGEDELCDSGRQRGEK
EDEDEDVKKRREKQRRRDRTRDRAADRIQFACSVCKFRSFDDEEIQKHLQSKFHKETLRF
ISTKLPDKTVEFLQEYIVNRNKKIEKRRQELMEKETAKPKPDPFKGIGQEHFFKKIEAAH
CLACDMLIPAQPQLLQRHLHSVDHNHNRRLAAEQFKKTSLHVAKSVLNNRHIVKMLEKYL
KGEDPFTSETVDPEMEGDDNLGGEDKKETPEEVAADVLAEVITAAVRAVDGEGAPAPESS
GEPAEDEGPTDTAEAGSDPQAEQLLEEQVPCGTAHEKGVPKARSEAAEAGNGAETMAAEA
ESAQTRVAPAPAAADAEVEQTDAESKDAVPTE

Sequence length

692

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Long QT syndrome	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (23)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Autistic Disorder	Autism	BEFREE	26076356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	26076356	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28755423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28755423, 32321829	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29528086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	26913922	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36691407	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	30990963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	28771997	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	30990963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26880274, 32338437	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	36691407	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	19834500		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	19834500		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	28755423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	28771997, 30990963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29528086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26823747	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	29397057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	30990963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	19834500		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	19834500		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

AKAP8 (A-kinase anchoring protein 8)