Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10268
Gene name	Receptor activity modifying protein 3
Gene symbol	RAMP3
Synonyms (NCBI Gene)	-
Chromosome	7
Chromosome location	7p13
Summary	The protein encoded by this gene is a member of the RAMP family of single-transmembrane-domain proteins, called receptor (calcitonin) activity modifying proteins (RAMPs). RAMPs are type I transmembrane proteins with an extracellular N terminus and a cytop

Show/Hide all (5)

miRTarBase ID	miRNA	Experiments
MIRT1289335	hsa-miR-3176	CLIP-seq
MIRT1289336	hsa-miR-3922-3p	CLIP-seq
MIRT1289337	hsa-miR-4419a	CLIP-seq
MIRT1289338	hsa-miR-4510	CLIP-seq
MIRT1289339	hsa-miR-4757-5p	CLIP-seq

Show/Hide all (55)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001540	Function	Amyloid-beta binding	IC	22500019
GO:0001605	Function	Adrenomedullin receptor activity	IPI	10882736
GO:0001921	Process	Positive regulation of receptor recycling	IDA	15613468
GO:0005515	Function	Protein binding	IPI	15613468, 22500019, 23674134, 25416956, 32296183
GO:0005764	Component	Lysosome	IDA	15613468
GO:0005764	Component	Lysosome	TAS	10882736
GO:0005886	Component	Plasma membrane	IDA	9620797
GO:0005886	Component	Plasma membrane	IDA	15613468, 23674134
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9620797
GO:0006816	Process	Calcium ion transport	IBA
GO:0006816	Process	Calcium ion transport	IDA	10882736
GO:0006886	Process	Intracellular protein transport	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	17110384, 32296767, 35324283
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IGI	22500019
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IPI	10882736
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	IEA
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IDA	10882736, 14722252
GO:0010628	Process	Positive regulation of gene expression	IGI	22500019
GO:0015026	Function	Coreceptor activity	IBA
GO:0015026	Function	Coreceptor activity	IDA	17916776, 35324283
GO:0015026	Function	Coreceptor activity	IEA
GO:0015031	Process	Protein transport	IBA
GO:0015031	Process	Protein transport	IDA	9620797, 10882736
GO:0016020	Component	Membrane	IEA
GO:0031623	Process	Receptor internalization	IBA
GO:0031623	Process	Receptor internalization	IDA	10882736, 15613468
GO:0032870	Process	Cellular response to hormone stimulus	IBA
GO:0038041	Process	Cross-receptor inhibition within G protein-coupled receptor heterodimer	IPI	14722252
GO:0043235	Component	Receptor complex	IBA
GO:0043235	Component	Receptor complex	IDA	15613468
GO:0050850	Process	Positive regulation of calcium-mediated signaling	IGI	22500019
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IGI	22500019
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IGI	22500019
GO:0071392	Process	Cellular response to estradiol stimulus	IEA
GO:0071392	Process	Cellular response to estradiol stimulus	ISS
GO:0072659	Process	Protein localization to plasma membrane	IBA
GO:0072659	Process	Protein localization to plasma membrane	IDA	10882736
GO:0086103	Process	G protein-coupled receptor signaling pathway involved in heart process	IEA
GO:0086103	Process	G protein-coupled receptor signaling pathway involved in heart process	ISS
GO:0097643	Function	Amylin receptor activity	IGI	22500019
GO:0097647	Process	Amylin receptor signaling pathway	IGI	22500019
GO:0141163	Process	Positive regulation of cAMP/PKA signal transduction	IGI	22500019
GO:0150058	Component	Amylin receptor complex 3	IDA	22500019
GO:0150061	Process	Amylin receptor 3 signaling pathway	IDA	35324283
GO:0150061	Process	Amylin receptor 3 signaling pathway	IDA	35324283
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	IDA	23674134
GO:1903143	Component	Adrenomedullin receptor complex	IDA	10882736
GO:1904645	Process	Response to amyloid-beta	IGI	22500019
GO:1990410	Process	Adrenomedullin receptor signaling pathway	IDA	32296767
GO:1990410	Process	Adrenomedullin receptor signaling pathway	IDA	17916776
GO:1990410	Process	Adrenomedullin receptor signaling pathway	IPI	10882736

MIM	HGNC	e!Ensembl
605155	9845	ENSG00000122679

O60896

Protein name

Receptor activity-modifying protein 3 (Calcitonin-receptor-like receptor activity-modifying protein 3) (CRLR activity-modifying protein 3)

Protein function

Accessory protein that interacts with and modulates the function of G-protein coupled receptors including calcitonin gene-related peptide type 1 receptor (CALCRL), calcitonin receptor (CALCR) and G-protein coupled estrogen receptor 1 (GPER1) (Pu

PDB

6UUS , 6UVA , 7TZF , 8F0K , 8F2A , 8F2B

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04901	RAMP	37 → 146	Receptor activity modifying family	Family

Tissue specificity

TISSUE SPECIFICITY: Strongly expressed in lung, breast, immune system and fetal tissues. {ECO:0000269|PubMed:9620797}.

Sequence

METGALRRPQLLPLLLLLCGGCPRAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLS
EFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLI
PLIVIPVVLTVAMAGLVVWRSKRTDTLL

Sequence length

148

Interactions

View interactions

	KEGG		Reactome
	Hormone signaling Vascular smooth muscle contraction		G alpha (s) signalling events Calcitonin-like ligand receptors ADORA2B mediated anti-inflammatory cytokines production

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
DIVERTICULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUCHENNE MUSCULAR DYSTROPHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (22)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adrenal Gland Neoplasms	Adrenal neoplasia	BEFREE	18460550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	33663605	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	31164693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	31164693	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	27039262	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15547717, 20802105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36081504, 36994451, 37275878	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23634287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	17878224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	17878224	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	28666334	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11943713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	11943713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	23674134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	27614623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29882679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29882679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	30385288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15547717, 19610056, 20802105, 23634287, 25409149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30385288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	21458987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	27039262	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RAMP3 (receptor activity modifying protein 3)