Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10267
Gene name	Receptor activity modifying protein 1
Gene symbol	RAMP1
Synonyms (NCBI Gene)	-
Chromosome	2
Chromosome location	2q37.3
Summary	The protein encoded by this gene is a member of the RAMP family of single-transmembrane-domain proteins, called receptor (calcitonin) activity modifying proteins (RAMPs). RAMPs are type I transmembrane proteins with an extracellular N terminus and a cytop

Show/Hide all (41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IDA	20596610
GO:0001635	Function	Calcitonin gene-related peptide receptor activity	IPI	9620797, 10882736, 14722252
GO:0005515	Function	Protein binding	IPI	9620797, 14722252, 16293613, 20596610, 20826335, 32296183, 33602864
GO:0005886	Component	Plasma membrane	IDA	9620797
GO:0005886	Component	Plasma membrane	IDA	18039931
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9620797
GO:0006816	Process	Calcium ion transport	IBA
GO:0006816	Process	Calcium ion transport	IDA	10882736
GO:0006886	Process	Intracellular protein transport	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	9620797, 17110384, 33602864, 35324283, 38603770
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	14722252
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IPI	9620797, 10882736
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	IEA
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IDA	14722252
GO:0015026	Function	Coreceptor activity	IBA
GO:0015026	Function	Coreceptor activity	IDA	9620797, 33602864, 35324283, 38603770
GO:0015026	Function	Coreceptor activity	IEA
GO:0015031	Process	Protein transport	IBA
GO:0015031	Process	Protein transport	IDA	10882736
GO:0016020	Component	Membrane	IEA
GO:0031623	Process	Receptor internalization	IBA
GO:0031623	Process	Receptor internalization	IDA	10882736, 15613468
GO:0032870	Process	Cellular response to hormone stimulus	IBA
GO:0043235	Component	Receptor complex	IBA
GO:0043235	Component	Receptor complex	IDA	15613468
GO:0060050	Process	Positive regulation of protein glycosylation	IDA	9620797
GO:0072659	Process	Protein localization to plasma membrane	IBA
GO:0072659	Process	Protein localization to plasma membrane	IDA	10882736
GO:0097643	Function	Amylin receptor activity	IPI	14722252
GO:0097647	Process	Amylin receptor signaling pathway	IDA	14722252
GO:0150059	Process	Amylin receptor 1 signaling pathway	IDA	35324283, 38603770
GO:0150059	Process	Amylin receptor 1 signaling pathway	IDA	35324283, 38603770
GO:1990406	Component	CGRP receptor complex	IDA	9620797, 10882736
GO:1990407	Function	Calcitonin gene-related peptide binding	IPI	9620797
GO:1990408	Process	Calcitonin gene-related peptide receptor signaling pathway	IDA	9620797, 33602864
GO:1990408	Process	Calcitonin gene-related peptide receptor signaling pathway	IDA	9620797, 33602864
GO:1990408	Process	Calcitonin gene-related peptide receptor signaling pathway	IPI	9620797, 10882736

MIM	HGNC	e!Ensembl
605153	9843	ENSG00000132329

O60894

Protein name

Receptor activity-modifying protein 1 (Calcitonin-receptor-like receptor activity-modifying protein 1) (CRLR activity-modifying protein 1)

Protein function

Accessory protein that interacts with and modulates the function of G-protein coupled receptors including calcitonin gene-related peptide type 1 receptor (CALCRL) and calcitonin receptor (CALCR) (PubMed:33602864, PubMed:9620797, PubMed:35324283,

PDB

2YX8 , 3N7P , 3N7R , 3N7S , 4RWG , 5V6Y , 6D1U , 6E3Y , 6UMG , 6ZHO , 6ZIS , 7KNT , 7KNU , 7P0F , 7P0I , 7TYF , 7TYW , 8AX5 , 8AX6 , 8AX7 , 9AUC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04901	RAMP	37 → 146	Receptor activity modifying family	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in many tissues including the uterus, bladder, brain, pancreas and gastro-intestinal tract. {ECO:0000269|PubMed:9620797}.

Sequence

MARALCRLPRRGLWLLLAHHLFMTTACQEANYGALLRELCLTQFQVDMEAVGETLWCDWG
RTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILY
PFIVVPITVTLLVTALVVWQSKRTEGIV

Sequence length

148

Interactions

View interactions

	KEGG		Reactome
	Hormone signaling Vascular smooth muscle contraction		G alpha (s) signalling events Calcitonin-like ligand receptors ADORA2B mediated anti-inflammatory cytokines production

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISORDER OF DEVELOPMENT OR MORPHOGENESIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (30)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute pancreatitis	Pancreatitis	BEFREE	31109903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	39188714	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arteriosclerosis	Arteriosclerosis	LHGDN	18198792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	20933260, 25010197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	39188714	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15547717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	19710695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	LHGDN	18198792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	27513455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Migraine	Common Migraine	BEFREE	25881990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysautonomia	Dysautonomia	BEFREE	29297736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	30804432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	28181496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	30741933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrous Meningioma	Fibrous Meningioma	BEFREE	18365142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	20100989, 21269690, 27614623, 29297736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19893039, 23867798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	17344407, 23237777, 26501962, 28856910, 30550780, 31756985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	23237777, 26501962, 34965002, 36627267, 40596821	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	33602248	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	18198792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	17493758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	37796823	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	31109903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19893039, 23867798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19893039	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	10777702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	36578802	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	36627267	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	24454825		★★★★★ ★☆☆☆☆ Found in Text Mining only

RAMP1 (receptor activity modifying protein 1)