Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10266
Gene name	Receptor activity modifying protein 2
Gene symbol	RAMP2
Synonyms (NCBI Gene)	-
Chromosome	17
Chromosome location	17q21.2
Summary	The protein encoded by this gene is a member of the RAMP family of single-transmembrane-domain proteins, called receptor (calcitonin) activity modifying proteins (RAMPs). RAMPs are type I transmembrane proteins with an extracellular N terminus and a cytop

Show/Hide all (9)

miRTarBase ID	miRNA	Experiments
MIRT1289326	hsa-miR-1255a	CLIP-seq
MIRT1289327	hsa-miR-1255b	CLIP-seq
MIRT1289328	hsa-miR-4450	CLIP-seq
MIRT1289329	hsa-miR-4693-3p	CLIP-seq
MIRT1289330	hsa-miR-4712-3p	CLIP-seq
MIRT1289331	hsa-miR-491-5p	CLIP-seq
MIRT1289332	hsa-miR-539	CLIP-seq
MIRT1289333	hsa-miR-541	CLIP-seq
MIRT1289334	hsa-miR-654-5p	CLIP-seq

Show/Hide all (67)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IBA
GO:0001525	Process	Angiogenesis	IDA	20596610
GO:0001570	Process	Vasculogenesis	IMP	16964401
GO:0001605	Function	Adrenomedullin receptor activity	IPI	9620797, 20074556, 22102369
GO:0002040	Process	Sprouting angiogenesis	IEA
GO:0002040	Process	Sprouting angiogenesis	ISS
GO:0005515	Function	Protein binding	IPI	9620797, 20596610, 22102369, 30115739, 32296183
GO:0005737	Component	Cytoplasm	IDA	10882736
GO:0005764	Component	Lysosome	TAS	10882736
GO:0005886	Component	Plasma membrane	IDA	9620797
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9620797
GO:0005905	Component	Clathrin-coated pit	TAS	10882736
GO:0006816	Process	Calcium ion transport	IBA
GO:0006816	Process	Calcium ion transport	IDA	10882736
GO:0006886	Process	Intracellular protein transport	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	17110384, 32296767, 35324283
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IPI	9620797, 10882736, 20074556, 22102369
GO:0007507	Process	Heart development	IEA
GO:0007507	Process	Heart development	ISS
GO:0008217	Process	Regulation of blood pressure	IEA
GO:0008217	Process	Regulation of blood pressure	ISS
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	IEA
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IDA	14722252
GO:0010628	Process	Positive regulation of gene expression	IDA	18097473
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0015026	Function	Coreceptor activity	IBA
GO:0015026	Function	Coreceptor activity	IDA	17916776, 35324283
GO:0015026	Function	Coreceptor activity	IEA
GO:0015026	Function	Coreceptor activity	ISS
GO:0015031	Process	Protein transport	IBA
GO:0015031	Process	Protein transport	IDA	9620797, 10882736
GO:0016020	Component	Membrane	IEA
GO:0031623	Process	Receptor internalization	IBA
GO:0031623	Process	Receptor internalization	IDA	10882736, 15613468, 20074556
GO:0032870	Process	Cellular response to hormone stimulus	IBA
GO:0034333	Process	Adherens junction assembly	IDA	18097473
GO:0034333	Process	Adherens junction assembly	IEA
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IEA
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	ISS
GO:0043116	Process	Negative regulation of vascular permeability	IDA	18097473
GO:0043116	Process	Negative regulation of vascular permeability	IEA
GO:0043235	Component	Receptor complex	IBA
GO:0043235	Component	Receptor complex	IDA	15613468
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0045766	Process	Positive regulation of angiogenesis	ISS
GO:0070830	Process	Bicellular tight junction assembly	IDA	18097473
GO:0070830	Process	Bicellular tight junction assembly	IEA
GO:0070831	Process	Basement membrane assembly	IEA
GO:0070831	Process	Basement membrane assembly	ISS
GO:0072659	Process	Protein localization to plasma membrane	IBA
GO:0072659	Process	Protein localization to plasma membrane	IDA	10882736
GO:0097084	Process	Vascular associated smooth muscle cell development	IEA
GO:0097084	Process	Vascular associated smooth muscle cell development	ISS
GO:0150060	Process	Amylin receptor 2 signaling pathway	IDA	35324283
GO:0150060	Process	Amylin receptor 2 signaling pathway	IDA	35324283
GO:1903143	Component	Adrenomedullin receptor complex	IDA	9620797, 10882736, 20074556, 22102369
GO:1990409	Function	Adrenomedullin binding	IPI	22102369
GO:1990410	Process	Adrenomedullin receptor signaling pathway	IDA	32296767
GO:1990410	Process	Adrenomedullin receptor signaling pathway	IDA	17916776
GO:1990410	Process	Adrenomedullin receptor signaling pathway	IPI	9620797, 10882736, 20074556, 22102369
GO:2000352	Process	Negative regulation of endothelial cell apoptotic process	IDA	18097473
GO:2000352	Process	Negative regulation of endothelial cell apoptotic process	IEA
GO:2001214	Process	Positive regulation of vasculogenesis	IEA

MIM	HGNC	e!Ensembl
605154	9844	ENSG00000131477

O60895

Protein name

Receptor activity-modifying protein 2 (Calcitonin-receptor-like receptor activity-modifying protein 2) (CRLR activity-modifying protein 2)

Protein function

Accessory protein that interacts with and modulates the function of G-protein coupled receptors including calcitonin gene-related peptide type 1 receptor (CALCRL) and calcitonin receptor (CALCR) (PubMed:9620797). Required for the transport of CA

PDB

2XVT , 3AQE , 3AQF , 4RWF , 6UUN , 6V2E , 7TYH , 7TYX , 7TYY

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04901	RAMP	65 → 173	Receptor activity modifying family	Family

Tissue specificity

TISSUE SPECIFICITY: Strongly expressed in lung, breast, immune system and fetal tissues. {ECO:0000269|PubMed:9620797}.

Sequence

MASLRVERAGGPRLPRTRVGRPAALRLLLLLGAVLNPHEALAQPLPTTGTPGSEGGTVKN
YETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERII
FETHQIHFANCSLVQPTFSDPPEDVLLAMIIAPICLIPFLITLVVWRSKDSEAQA

Sequence length

175

Interactions

View interactions

	KEGG		Reactome
	Hormone signaling Vascular smooth muscle contraction		G alpha (s) signalling events Calcitonin-like ligand receptors ADORA2B mediated anti-inflammatory cytokines production

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
GLAUCOMA, OPEN-ANGLE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RAMP2-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (41)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	17671114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	17671114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	17671114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	17671114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	17102095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	20942979	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	21400501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17671114, 30542454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	17671114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	17671114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	25252154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	28904253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	17878224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	17878224	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	28666334	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	14717924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	30718926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	14717924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	31000793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperoxia	Hyperoxia	Pubtator	34911614	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	27614623		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney Disease	BEFREE	24505304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	17671114		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	17671114		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of lung	Lung Cancer	BEFREE	17671114, 30542454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	17671114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marinesco-Sjogren syndrome	Marinesco-Sjogren Syndrome	BEFREE	21400501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19610056, 31150417, 31754214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	26923268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	15315911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	34271220	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	26035796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	31622249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	17102095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	21458987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	23585227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	CTD_human_DG	25070658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	16622024, 19210874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	10777702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	28904253	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	28324104		★★★★★ ★☆☆☆☆ Found in Text Mining only

RAMP2 (receptor activity modifying protein 2)