Gene Gene information from NCBI Gene database.
Entrez ID 10254
Gene name Signal transducing adaptor molecule 2
Gene symbol STAM2
Synonyms (NCBI Gene)
HbpSTAM2ASTAM2B
Chromosome 2
Chromosome location 2q23.3
Summary The protein encoded by this gene is closely related to STAM, an adaptor protein involved in the downstream signaling of cytokine receptors, both of which contain a SH3 domain and the immunoreceptor tyrosine-based activation motif (ITAM). Similar to STAM,
miRNA miRNA information provided by mirtarbase database.
497
miRTarBase ID miRNA Experiments Reference
MIRT005005 hsa-miR-218-5p Luciferase reporter assayqRT-PCR 19890957
MIRT025220 hsa-miR-34a-5p Proteomics 21566225
MIRT037384 hsa-miR-744-5p CLASH 23622248
MIRT1394793 hsa-miR-1208 CLIP-seq
MIRT1394794 hsa-miR-1262 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
23
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 15231748, 16189514, 16730941, 17235283, 17403676, 19060904, 23275563, 25416956, 25910212, 27725184, 29892012, 31515488, 32296183, 32814053, 35271311
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IDA
GO:0005737 Component Cytoplasm IEA
GO:0005768 Component Endosome IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606244 11358 ENSG00000115145
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O75886
Protein name Signal transducing adapter molecule 2 (STAM-2) (Hrs-binding protein)
Protein function Involved in intracellular signal transduction mediated by cytokines and growth factors. Upon IL-2 and GM-CSL stimulation, it plays a role in signaling leading to DNA synthesis and MYC induction. May also play a role in T-cell development. Involv
PDB 1X2Q , 1X5B , 2L0T , 5CRV , 5IXF
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00790 VHS 4 140 VHS domain Domain
PF02809 UIM 165 181 Ubiquitin interaction motif Motif
PF00018 SH3_1 208 253 SH3 domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:10899310}.
Sequence
MPLFTANPFEQDVEKATNEYNTTEDWSLIMDICDKVGSTPNGAKDCLKAIMKRVNHKVPH
VALQALTLLGACVANCGKIFHLEVCSRDFATEVRAVIKNKAHPKVCEKLKSLMVEWSEEF
QKDPQFSLISATIKSMKEEG
ITFPPAGSQTVSAAAKNGTSSNKNKEDEDIAKAIELSLQE
Q
KQQHTETKSLYPSSEIQLNNKVARKVRALYDFEAVEDNELTFKHGEIIIVLDDSDANWW
KGENHRGIGLFPS
NFVTTNLNIETEAAAVDKLNVIDDDVEEIKKSEPEPVYIDEDKMDRA
LQVLQSIDPTDSKPDSQDLLDLEDICQQMGPMIDEKLEEIDRKHSELSELNVKVLEALEL
YNKLVNEAPVYSVYSKLHPPAHYPPASSGVPMQTYPVQSHGGNYMGQSIHQVTVAQSYSL
GPDQIGPLRSLPPNVNSSVTAQPAQTSYLSTGQDTVSNPTYMNQNSNLQSATGTTAYTQQ
MGMSVDMSSYQNTTSNLPQLAGFPVTVPAHPVAQQHTNYHQQPLL
Sequence length 525
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Endocytosis
JAK-STAT signaling pathway
  EGFR downregulation
Ub-specific processing proteases
Negative regulation of MET activity
Cargo recognition for clathrin-mediated endocytosis
Clathrin-mediated endocytosis
Endosomal Sorting Complex Required For Transport (ESCRT)
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
METABOLIC SYNDROME GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Chronic Obstructive Airway Disease Chronic Obstructive Pulmonary Disease BEFREE 28985325
★☆☆☆☆
Found in Text Mining only
Congestive heart failure Congestive Heart Failure BEFREE 28985325
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent Diabetes Mellitus BEFREE 28819987, 29447439, 29548933, 31081363, 31711859
★☆☆☆☆
Found in Text Mining only
Diabetic Nephropathy Diabetic Nephropathy BEFREE 28819987, 29540826, 29548933, 30884176, 31711859
★☆☆☆☆
Found in Text Mining only
Hepatocellular Adenoma Hepatocellular adenoma BEFREE 30937584
★☆☆☆☆
Found in Text Mining only
Hypertensive disease Hypertension BEFREE 28575205, 28903744, 29548933, 30557811
★☆☆☆☆
Found in Text Mining only
Inflammatory Myofibroblastic Tumor Inflammatory Myofibroblastic Tumor BEFREE 30515535
★☆☆☆☆
Found in Text Mining only
Intrahepatic Cholangiocarcinoma Intrahepatic Cholangiocarcinoma BEFREE 30515535
★☆☆☆☆
Found in Text Mining only
Kidney Failure, Acute Kidney Failure BEFREE 28319494, 28585315
★☆☆☆☆
Found in Text Mining only
Left Bundle-Branch Block Left Bundle-Branch Block BEFREE 30497723, 31746996
★☆☆☆☆
Found in Text Mining only