SPRY2 (sprouty RTK signaling antagonist 2)

Gene

• Entrez ID: 10253
• Gene name: Sprouty RTK signaling antagonist 2
• Gene symbol: SPRY2
• Synonyms (NCBI Gene): IGAN3, hSPRY2
• Chromosome: 13
• Chromosome location: 13q31.1
• Summary: This gene encodes a protein belonging to the sprouty family. The encoded protein contains a carboxyl-terminal cysteine-rich domain essential for the inhibitory activity on receptor tyrosine kinase signaling proteins and is required for growth factor stimu

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs869025336	G>A,T	Risk-factor	Coding sequence variant, missense variant, synonymous variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000672	hsa-miR-21-5p	Review	19935707
MIRT000672	hsa-miR-21-5p	Luciferase reporter assay	18508928
MIRT005511	hsa-miR-27a-3p	Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	20638779
MIRT005511	hsa-miR-27a-3p	Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	20638779
MIRT000672	hsa-miR-21-5p	Luciferase reporter assay, qRT-PCR	21278789
MIRT000672	hsa-miR-21-5p	Luciferase reporter assay, qRT-PCR	21278789
MIRT000672	hsa-miR-21-5p	Luciferase reporter assay	23239100
MIRT022159	hsa-miR-124-3p	Microarray	18668037
MIRT023487	hsa-miR-1-3p	Microarray	18668037
MIRT025117	hsa-miR-181a-5p	Sequencing	20371350
MIRT025980	hsa-miR-148a-3p	Sequencing	20371350
MIRT028756	hsa-miR-26b-5p	Microarray	19088304
MIRT005511	hsa-miR-27a-3p	qRT-PCR, Western blot	23650389
MIRT438903	hsa-miR-23a-3p	ChIP-seq, Luciferase reporter assay, qRT-PCR, Western blot	23649631
MIRT438902	hsa-miR-24-2-5p	ChIP-seq, Luciferase reporter assay, qRT-PCR, Western blot	23649631
MIRT005511	hsa-miR-27a-3p	ChIP-seq, Luciferase reporter assay, qRT-PCR, Western blot	23649631
MIRT438903	hsa-miR-23a-3p	ChIP-seq, Luciferase reporter assay, qRT-PCR, Western blot	23649631
MIRT438902	hsa-miR-24-2-5p	ChIP-seq, Luciferase reporter assay, qRT-PCR, Western blot	23649631
MIRT005511	hsa-miR-27a-3p	ChIP-seq, Luciferase reporter assay, qRT-PCR, Western blot	23649631
MIRT000672	hsa-miR-21-5p	qRT-PCR, Western blot	25728247
MIRT005511	hsa-miR-27a-3p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), Immunofluorescence, qRT-PCR	33638619
MIRT000672	hsa-miR-21-5p	Luciferase reporter assay, Western blotting, Immunofluorescence, qRT-PCR	33116513
MIRT755693	ebv-miR-BART1-5p	Luciferase reporter assay, Immunohistochemistry (IHC)	37097161
MIRT000672	hsa-miR-21-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunoprecipitaion (IP)	34786052
MIRT1386032	hsa-miR-103a	CLIP-seq
MIRT1386033	hsa-miR-107	CLIP-seq
MIRT1386034	hsa-miR-1301	CLIP-seq
MIRT1386035	hsa-miR-3607-3p	CLIP-seq
MIRT1386036	hsa-miR-3686	CLIP-seq
MIRT1386037	hsa-miR-4520a-3p	CLIP-seq
MIRT1386038	hsa-miR-4520b-3p	CLIP-seq
MIRT1386039	hsa-miR-5047	CLIP-seq
MIRT1386040	hsa-miR-579	CLIP-seq
MIRT1386041	hsa-miR-586	CLIP-seq
MIRT2115513	hsa-miR-3148	CLIP-seq
MIRT1386036	hsa-miR-3686	CLIP-seq
MIRT2115514	hsa-miR-3688-3p	CLIP-seq
MIRT2115515	hsa-miR-4452	CLIP-seq
MIRT2115516	hsa-miR-4742-3p	CLIP-seq
MIRT2115517	hsa-miR-548m	CLIP-seq
MIRT2338162	hsa-miR-122	CLIP-seq
MIRT2338163	hsa-miR-21	CLIP-seq
MIRT2338164	hsa-miR-3135	CLIP-seq
MIRT2338165	hsa-miR-3152-5p	CLIP-seq
MIRT2338166	hsa-miR-4774-3p	CLIP-seq
MIRT2338167	hsa-miR-4802-3p	CLIP-seq
MIRT2338168	hsa-miR-491-3p	CLIP-seq
MIRT2338169	hsa-miR-590-5p	CLIP-seq
MIRT2395049	hsa-miR-338-5p	CLIP-seq
MIRT2631773	hsa-miR-128	CLIP-seq
MIRT2631774	hsa-miR-27a	CLIP-seq
MIRT2631775	hsa-miR-27b	CLIP-seq
MIRT2631776	hsa-miR-4684-3p	CLIP-seq
MIRT2631777	hsa-miR-5096	CLIP-seq
MIRT2631778	hsa-miR-513a-5p	CLIP-seq
MIRT2631779	hsa-miR-518a-5p	CLIP-seq
MIRT2631780	hsa-miR-527	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CREB1	Unknown	14644509
ETS1	Unknown	14644509
SP1	Unknown	14644509
TFAP2A	Unknown	14644509

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000132	Process	Establishment of mitotic spindle orientation	IEA
GO:0005515	Function	Protein binding	IPI	12815057, 15962011, 16189514, 16877379, 16893902, 17974561, 18273061, 21516116, 21784977, 24722188, 25416956, 25910212, 29408807, 29892012, 31515488, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005856	Component	Cytoskeleton	ISS
GO:0005874	Component	Microtubule	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007605	Process	Sensory perception of sound	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IEA
GO:0009966	Process	Regulation of signal transduction	IEA
GO:0010628	Process	Positive regulation of gene expression	IMP	18070883
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	IEA
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	ISS
GO:0015629	Component	Actin cytoskeleton	IDA
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	ISS
GO:0016525	Process	Negative regulation of angiogenesis	IMP	24177325
GO:0019901	Function	Protein kinase binding	IPI	20736167
GO:0030291	Function	Protein serine/threonine kinase inhibitor activity	IDA	20736167
GO:0030324	Process	Lung development	IEA
GO:0030335	Process	Positive regulation of cell migration	IMP	20489163
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IEA
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	ISS
GO:0031345	Process	Negative regulation of cell projection organization	IEA
GO:0031345	Process	Negative regulation of cell projection organization	ISS
GO:0031397	Process	Negative regulation of protein ubiquitination	IDA	17974561
GO:0032587	Component	Ruffle membrane	IEA
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	IMP	18070883
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IDA	21536891
GO:0040037	Process	Negative regulation of fibroblast growth factor receptor signaling pathway	IBA
GO:0040037	Process	Negative regulation of fibroblast growth factor receptor signaling pathway	IEA
GO:0042472	Process	Inner ear morphogenesis	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	18070883
GO:0043539	Function	Protein serine/threonine kinase activator activity	IMP	18070883
GO:0045165	Process	Cell fate commitment	IEA
GO:0045742	Process	Positive regulation of epidermal growth factor receptor signaling pathway	IEA
GO:0046580	Process	Negative regulation of Ras protein signal transduction	IBA
GO:0046580	Process	Negative regulation of Ras protein signal transduction	IEA
GO:0048513	Process	Animal organ development	IBA
GO:0048754	Process	Branching morphogenesis of an epithelial tube	IEA
GO:0051387	Process	Negative regulation of neurotrophin TRK receptor signaling pathway	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	18070883
GO:0055105	Function	Ubiquitin-protein transferase inhibitor activity	IEA
GO:0060425	Process	Lung morphogenesis	IEA
GO:0060437	Process	Lung growth	IEA
GO:0060449	Process	Bud elongation involved in lung branching	IEA
GO:0060541	Process	Respiratory system development	IEA
GO:0070371	Process	ERK1 and ERK2 cascade	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IBA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IDA	21536891
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IMP	20489163
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	ISS
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	18070883
GO:0140678	Function	Molecular function inhibitor activity	IEA
GO:1900747	Process	Negative regulation of vascular endothelial growth factor signaling pathway	IDA	21536891
GO:1902747	Process	Negative regulation of lens fiber cell differentiation	IEA
GO:1902747	Process	Negative regulation of lens fiber cell differentiation	ISS
GO:1990752	Component	Microtubule end	IDA
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA

Other IDs

• MIM: 602466
• HGNC: 11270
• e!Ensembl: ENSG00000136158

Protein

• UniProt ID: O43597
• Protein name: Protein sprouty homolog 2 (Spry-2)
• Protein function: Antagonist of fibroblast growth factor (FGF) pathways via inhibition of FGF-mediated phosphorylation of ERK1/2 (By similarity). Thereby acts as an antagonist of FGF-induced retinal lens fiber differentiation, may inhibit limb bud outgrowth and m
• PDB: 3BUM, 3OB1, 5HKY, 5HKZ, 5HL0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05210	Sprouty	183 → 294	Sprouty protein (Spry)	Family

• Sequence:

  MEARAQSGNGSQPLLQTPRDGGRQRGEPDPRDALTQQVHVLSLDQIRAIRNTNEYTEGPT
  VVPRPGLKPAPRPSTQHKHERLHGLPEHRQPPRLQHSQVHSSARAPLSRSISTVSSGSRS
  STRTSTSSSSSEQRLLGSSFSSGPVADGIIRVQPKSELKPGELKPLSKEDLGLHAYRCED
  CGKCKCKECTYPRPLPSDWICDKQCLCSAQNVIDYGTCVCCVKGLFYHCSNDDEDNCADN
  PCSCSQSHCCTRWSAMGVMSLFLPCLWCYLPAKGCLKLCQGCYDRVNRPGCRCKNSNTVC
  CKVPTVPPRNFEKPT

• Sequence length: 315

Pathways

KEGG:

MicroRNAs in cancer

Reactome:

Spry regulation of FGF signaling
EGFR downregulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEFT LIP	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEFT PALATE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEFT UPPER LIP	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLETE UNILATERAL CLEFT LIP	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRANIOFACIAL ABNORMALITIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GILLES DE LA TOURETTE SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IgA nephropathy, susceptibility to, 3	Uncertain significance; risk factor	ClinVar ClinVar, GenCC	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
LUNG DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPRY2-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	20638779		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30464258, 30691517		★☆☆☆☆ Found in Text Mining only
Aortic Valve Calcification of	Aortic valve disease	Pubtator	35865542	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	25935347		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	19147787		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	15735753		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	30156739		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21909357		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35394843	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	20543868, 23624922		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	17717605, 36749775	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	39778021	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	27078887	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	25533808	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	25533808		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	20560046		★☆☆☆☆ Found in Text Mining only
Cartilage-hair hypoplasia	Cartilage-Hair Hypoplasia	BEFREE	23643382		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	27415760	Inhibit	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	31235073		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	27677077		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	27677077		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	30160357	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	26809508		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	21932411		★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	16327884, 28662356, 29162626	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cleft Lip with or without Cleft Palate	Cleft Lip With Or Without Cleft Palate	BEFREE	25339627		★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	16327884, 30273098, 35110662	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon Carcinoma	Colon Carcinoma	BEFREE	20543868, 20624167, 21099344, 22322462, 23624922, 26293890, 26455323		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	26455323		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	26455323	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26293890, 26434583		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26455323, 34685612	Associate	★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	30156739		★☆☆☆☆ Found in Text Mining only
Congenital cataract	Congenital Cataract	BEFREE	19022413		★☆☆☆☆ Found in Text Mining only
Contiguous gene syndrome	Contiguous gene syndrome	BEFREE	19022413		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23688375		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	25935347		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	31664995	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	21909839, 24969401, 31664995		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	25533808		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	18048363		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	25303175		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	28002800		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	20406234, 39682716	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29635363		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	25934697, 29635363		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25934697, 29228449, 29228450		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	29228450	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	25782674	Associate	★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	18427547		★☆☆☆☆ Found in Text Mining only
Hyalinosis, Systemic	Hyalinosis	BEFREE	28715540		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	22006925	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	28196140	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29637273		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	22131235, 25782674		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA Glomerulonephritis	Glomerulonephritis	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immune System Diseases	Immune system disease	Pubtator	35865542	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	31664995	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	30160357		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	24923295, 31164492	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16489004, 18214995, 21932411, 22484587, 22617155, 26846382, 30464168		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	16489004, 18214995		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	21932411, 25303175		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	CTD_human_DG	24210189		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	15136453		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	29371906	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Lymphoma	BEFREE	19147787		★☆☆☆☆ Found in Text Mining only
Lymphoma, Diffuse	Lymphoma	BEFREE	18427547		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	18427547		★☆☆☆☆ Found in Text Mining only
Macroglossia	Macroglossia	BEFREE	26365529		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15342396		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	18214995, 22617155		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	15136453		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15735753, 23434594, 29373811, 30250598, 30301636		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26781754, 29949784		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	21134562		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15735753, 18427547, 22322462, 22484587, 29373811		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	27677077		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	20543868, 20624167, 21099344, 22322462, 23624922, 26293890, 26455323		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	15313890		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	31664995		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	35865542	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	25633921, 25825239, 27016275, 30837325		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	25633921, 25825239	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	35394843	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15735753, 16489004, 17510316, 18048363, 18214995, 18427547, 19147787, 21099344, 22322462, 22484587, 23434594, 23688375, 25934697, 25935347, 26265114, 26455323, 27835572, 29373811, 29540470, 29635363		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	29635363		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	LHGDN	17388787		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	17388787	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	17510316		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	31664995	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	25728247, 31696462		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	31696462	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian hyperstimulation syndrome	Pubtator	27539669	Stimulate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25533808, 27835572	Inhibit	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	24094449		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	36750863	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15735753, 16954433, 23434594, 29373811, 30250598, 30301636		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15735753, 16954433		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	27943426		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23688375		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	37179305	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	29445192		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	29445192	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	25935347, 26265114, 30503061		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	17943972		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	29291435		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26781754, 29949784		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	24094449	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	21134562		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	21134562		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	27677077	Associate	★☆☆☆☆ Found in Text Mining only