SPRY1 (sprouty RTK signaling antagonist 1)

Gene

• Entrez ID: 10252
• Gene name: Sprouty RTK signaling antagonist 1
• Gene symbol: SPRY1
• Synonyms (NCBI Gene): hSPRY1
• Chromosome: 4
• Chromosome location: 4q28.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT027552	hsa-miR-98-5p	Microarray	19088304
MIRT029134	hsa-miR-26b-5p	Microarray	19088304
MIRT042959	hsa-miR-324-3p	CLASH	23622248
MIRT052850	hsa-miR-3615	CLASH	23622248
MIRT539980	hsa-miR-548a-3p	HITS-CLIP	21572407
MIRT539979	hsa-miR-548ar-3p	HITS-CLIP	21572407
MIRT539978	hsa-miR-548az-3p	HITS-CLIP	21572407
MIRT539977	hsa-miR-548e-3p	HITS-CLIP	21572407
MIRT539976	hsa-miR-548f-3p	HITS-CLIP	21572407
MIRT539975	hsa-miR-548av-3p	HITS-CLIP	21572407
MIRT539974	hsa-miR-944	HITS-CLIP	21572407
MIRT539972	hsa-miR-5003-3p	HITS-CLIP	21572407
MIRT539973	hsa-miR-1323	HITS-CLIP	21572407
MIRT539971	hsa-miR-548o-3p	HITS-CLIP	21572407
MIRT539970	hsa-miR-4714-3p	HITS-CLIP	21572407
MIRT707190	hsa-miR-4275	HITS-CLIP	21572407
MIRT539969	hsa-miR-1180-5p	HITS-CLIP	21572407
MIRT539968	hsa-miR-7114-3p	HITS-CLIP	21572407
MIRT539967	hsa-miR-767-5p	HITS-CLIP	21572407
MIRT539966	hsa-miR-500a-3p	HITS-CLIP	21572407
MIRT539965	hsa-miR-450b-5p	HITS-CLIP	21572407
MIRT539964	hsa-miR-507	HITS-CLIP	21572407
MIRT539963	hsa-miR-557	HITS-CLIP	21572407
MIRT539962	hsa-miR-3680-3p	HITS-CLIP	21572407
MIRT539961	hsa-miR-548ae-3p	HITS-CLIP	21572407
MIRT539960	hsa-miR-548aj-3p	HITS-CLIP	21572407
MIRT539959	hsa-miR-548aq-3p	HITS-CLIP	21572407
MIRT539958	hsa-miR-548s	HITS-CLIP	21572407
MIRT539957	hsa-miR-548x-3p	HITS-CLIP	21572407
MIRT565477	hsa-miR-4426	PAR-CLIP	20371350
MIRT565476	hsa-miR-4647	PAR-CLIP	20371350
MIRT565475	hsa-miR-4662b	PAR-CLIP	20371350
MIRT565474	hsa-miR-5586-3p	PAR-CLIP	20371350
MIRT565473	hsa-miR-4699-5p	PAR-CLIP	20371350
MIRT539980	hsa-miR-548a-3p	PAR-CLIP	21572407
MIRT539979	hsa-miR-548ar-3p	PAR-CLIP	21572407
MIRT539978	hsa-miR-548az-3p	PAR-CLIP	21572407
MIRT539977	hsa-miR-548e-3p	PAR-CLIP	21572407
MIRT539976	hsa-miR-548f-3p	PAR-CLIP	21572407
MIRT539975	hsa-miR-548av-3p	PAR-CLIP	21572407
MIRT539974	hsa-miR-944	PAR-CLIP	21572407
MIRT539972	hsa-miR-5003-3p	PAR-CLIP	21572407
MIRT539973	hsa-miR-1323	PAR-CLIP	21572407
MIRT539971	hsa-miR-548o-3p	PAR-CLIP	21572407
MIRT539970	hsa-miR-4714-3p	PAR-CLIP	21572407
MIRT539969	hsa-miR-1180-5p	PAR-CLIP	21572407
MIRT539968	hsa-miR-7114-3p	PAR-CLIP	21572407
MIRT539967	hsa-miR-767-5p	PAR-CLIP	21572407
MIRT539966	hsa-miR-500a-3p	PAR-CLIP	21572407
MIRT539965	hsa-miR-450b-5p	PAR-CLIP	21572407
MIRT539964	hsa-miR-507	PAR-CLIP	21572407
MIRT539963	hsa-miR-557	PAR-CLIP	21572407
MIRT539962	hsa-miR-3680-3p	PAR-CLIP	21572407
MIRT539961	hsa-miR-548ae-3p	PAR-CLIP	21572407
MIRT539960	hsa-miR-548aj-3p	PAR-CLIP	21572407
MIRT539959	hsa-miR-548aq-3p	PAR-CLIP	21572407
MIRT539958	hsa-miR-548s	PAR-CLIP	21572407
MIRT539957	hsa-miR-548x-3p	PAR-CLIP	21572407
MIRT496719	hsa-miR-6816-3p	PAR-CLIP	22291592
MIRT496718	hsa-miR-4428	PAR-CLIP	22291592
MIRT496717	hsa-miR-3173-3p	PAR-CLIP	22291592
MIRT496716	hsa-miR-6891-5p	PAR-CLIP	22291592
MIRT496715	hsa-miR-6512-5p	PAR-CLIP	22291592
MIRT496714	hsa-miR-3619-3p	PAR-CLIP	22291592
MIRT496713	hsa-miR-505-5p	PAR-CLIP	22291592
MIRT496712	hsa-miR-4477b	PAR-CLIP	22291592
MIRT735093	hsa-miR-21-3p	Luciferase reporter assay, qRT-PCR, ELISA	32634115
MIRT735093	hsa-miR-21-3p	ELISA, Luciferase reporter assay, qRT-PCR	32632603
MIRT000174	hsa-miR-21-5p	Microarray, RNA-seq, qRT-PCR, Flow cytometry	31863364
MIRT539980	hsa-miR-548a-3p	HITS-CLIP	21572407
MIRT539979	hsa-miR-548ar-3p	HITS-CLIP	21572407
MIRT539978	hsa-miR-548az-3p	HITS-CLIP	21572407
MIRT539977	hsa-miR-548e-3p	HITS-CLIP	21572407
MIRT539976	hsa-miR-548f-3p	HITS-CLIP	21572407
MIRT539975	hsa-miR-548av-3p	HITS-CLIP	21572407
MIRT539974	hsa-miR-944	HITS-CLIP	21572407
MIRT539972	hsa-miR-5003-3p	HITS-CLIP	21572407
MIRT539973	hsa-miR-1323	HITS-CLIP	21572407
MIRT539971	hsa-miR-548o-3p	HITS-CLIP	21572407
MIRT539970	hsa-miR-4714-3p	HITS-CLIP	21572407
MIRT707190	hsa-miR-4275	HITS-CLIP	21572407
MIRT539969	hsa-miR-1180-5p	HITS-CLIP	21572407
MIRT539968	hsa-miR-7114-3p	HITS-CLIP	21572407
MIRT539967	hsa-miR-767-5p	HITS-CLIP	21572407
MIRT539966	hsa-miR-500a-3p	HITS-CLIP	21572407
MIRT539965	hsa-miR-450b-5p	HITS-CLIP	21572407
MIRT539964	hsa-miR-507	HITS-CLIP	21572407
MIRT539963	hsa-miR-557	HITS-CLIP	21572407
MIRT539962	hsa-miR-3680-3p	HITS-CLIP	21572407
MIRT539961	hsa-miR-548ae-3p	HITS-CLIP	21572407
MIRT539960	hsa-miR-548aj-3p	HITS-CLIP	21572407
MIRT539959	hsa-miR-548aq-3p	HITS-CLIP	21572407
MIRT539958	hsa-miR-548s	HITS-CLIP	21572407
MIRT539957	hsa-miR-548x-3p	HITS-CLIP	21572407
MIRT565477	hsa-miR-4426	PAR-CLIP	20371350
MIRT565476	hsa-miR-4647	PAR-CLIP	20371350
MIRT565475	hsa-miR-4662b	PAR-CLIP	20371350
MIRT565474	hsa-miR-5586-3p	PAR-CLIP	20371350
MIRT565473	hsa-miR-4699-5p	PAR-CLIP	20371350
MIRT539980	hsa-miR-548a-3p	PAR-CLIP	21572407
MIRT539979	hsa-miR-548ar-3p	PAR-CLIP	21572407
MIRT539978	hsa-miR-548az-3p	PAR-CLIP	21572407
MIRT539977	hsa-miR-548e-3p	PAR-CLIP	21572407
MIRT539976	hsa-miR-548f-3p	PAR-CLIP	21572407
MIRT539975	hsa-miR-548av-3p	PAR-CLIP	21572407
MIRT539974	hsa-miR-944	PAR-CLIP	21572407
MIRT539972	hsa-miR-5003-3p	PAR-CLIP	21572407
MIRT539973	hsa-miR-1323	PAR-CLIP	21572407
MIRT539971	hsa-miR-548o-3p	PAR-CLIP	21572407
MIRT539970	hsa-miR-4714-3p	PAR-CLIP	21572407
MIRT539969	hsa-miR-1180-5p	PAR-CLIP	21572407
MIRT539968	hsa-miR-7114-3p	PAR-CLIP	21572407
MIRT539967	hsa-miR-767-5p	PAR-CLIP	21572407
MIRT539966	hsa-miR-500a-3p	PAR-CLIP	21572407
MIRT539965	hsa-miR-450b-5p	PAR-CLIP	21572407
MIRT539964	hsa-miR-507	PAR-CLIP	21572407
MIRT539963	hsa-miR-557	PAR-CLIP	21572407
MIRT539962	hsa-miR-3680-3p	PAR-CLIP	21572407
MIRT539961	hsa-miR-548ae-3p	PAR-CLIP	21572407
MIRT539960	hsa-miR-548aj-3p	PAR-CLIP	21572407
MIRT539959	hsa-miR-548aq-3p	PAR-CLIP	21572407
MIRT539958	hsa-miR-548s	PAR-CLIP	21572407
MIRT539957	hsa-miR-548x-3p	PAR-CLIP	21572407
MIRT496719	hsa-miR-6816-3p	PAR-CLIP	22291592
MIRT496718	hsa-miR-4428	PAR-CLIP	22291592
MIRT496717	hsa-miR-3173-3p	PAR-CLIP	22291592
MIRT496716	hsa-miR-6891-5p	PAR-CLIP	22291592
MIRT496715	hsa-miR-6512-5p	PAR-CLIP	22291592
MIRT496714	hsa-miR-3619-3p	PAR-CLIP	22291592
MIRT496713	hsa-miR-505-5p	PAR-CLIP	22291592
MIRT496712	hsa-miR-4477b	PAR-CLIP	22291592
MIRT1386024	hsa-miR-3614-5p	CLIP-seq
MIRT1386025	hsa-miR-4433	CLIP-seq
MIRT1386026	hsa-miR-4459	CLIP-seq
MIRT1386027	hsa-miR-4642	CLIP-seq
MIRT1386028	hsa-miR-4768-3p	CLIP-seq
MIRT1386029	hsa-miR-488	CLIP-seq
MIRT1386030	hsa-miR-548n	CLIP-seq
MIRT1386031	hsa-miR-548t	CLIP-seq
MIRT2115512	hsa-miR-3611	CLIP-seq
MIRT2338141	hsa-miR-129-3p	CLIP-seq
MIRT2338142	hsa-miR-1305	CLIP-seq
MIRT2338143	hsa-miR-132	CLIP-seq
MIRT2338144	hsa-miR-182	CLIP-seq
MIRT2338145	hsa-miR-187	CLIP-seq
MIRT2338146	hsa-miR-212	CLIP-seq
MIRT2338147	hsa-miR-3651	CLIP-seq
MIRT2338148	hsa-miR-3684	CLIP-seq
MIRT2338149	hsa-miR-3691-3p	CLIP-seq
MIRT2338150	hsa-miR-374c	CLIP-seq
MIRT2338151	hsa-miR-421	CLIP-seq
MIRT2338152	hsa-miR-4424	CLIP-seq
MIRT2338153	hsa-miR-455-3p	CLIP-seq
MIRT2338154	hsa-miR-4659a-3p	CLIP-seq
MIRT2338155	hsa-miR-4659b-3p	CLIP-seq
MIRT2338156	hsa-miR-4687-5p	CLIP-seq
MIRT2338157	hsa-miR-4709-5p	CLIP-seq
MIRT2338158	hsa-miR-582-3p	CLIP-seq
MIRT2338159	hsa-miR-597	CLIP-seq
MIRT2338160	hsa-miR-628-5p	CLIP-seq
MIRT2338161	hsa-miR-655	CLIP-seq
MIRT2433523	hsa-miR-1468	CLIP-seq
MIRT2433524	hsa-miR-3145-3p	CLIP-seq
MIRT2631751	hsa-miR-1252	CLIP-seq
MIRT2631752	hsa-miR-1253	CLIP-seq
MIRT2631753	hsa-miR-205	CLIP-seq
MIRT2631754	hsa-miR-3065-5p	CLIP-seq
MIRT2631755	hsa-miR-3185	CLIP-seq
MIRT2631756	hsa-miR-342-5p	CLIP-seq
MIRT2338149	hsa-miR-3691-3p	CLIP-seq
MIRT2631757	hsa-miR-371b-3p	CLIP-seq
MIRT2631758	hsa-miR-383	CLIP-seq
MIRT2631759	hsa-miR-4282	CLIP-seq
MIRT2631760	hsa-miR-4290	CLIP-seq
MIRT2338152	hsa-miR-4424	CLIP-seq
MIRT2631761	hsa-miR-4476	CLIP-seq
MIRT2631762	hsa-miR-4651	CLIP-seq
MIRT2631763	hsa-miR-4664-5p	CLIP-seq
MIRT2631764	hsa-miR-4710	CLIP-seq
MIRT2631765	hsa-miR-4719	CLIP-seq
MIRT2631766	hsa-miR-4772-5p	CLIP-seq
MIRT2631767	hsa-miR-4789-3p	CLIP-seq
MIRT2631768	hsa-miR-4792	CLIP-seq
MIRT2631769	hsa-miR-513b	CLIP-seq
MIRT2631770	hsa-miR-549	CLIP-seq
MIRT2631771	hsa-miR-608	CLIP-seq
MIRT2631772	hsa-miR-642b	CLIP-seq
MIRT2631751	hsa-miR-1252	CLIP-seq
MIRT2631752	hsa-miR-1253	CLIP-seq
MIRT2631753	hsa-miR-205	CLIP-seq
MIRT2631754	hsa-miR-3065-5p	CLIP-seq
MIRT2631755	hsa-miR-3185	CLIP-seq
MIRT2631756	hsa-miR-342-5p	CLIP-seq
MIRT2338149	hsa-miR-3691-3p	CLIP-seq
MIRT2631757	hsa-miR-371b-3p	CLIP-seq
MIRT2631758	hsa-miR-383	CLIP-seq
MIRT2631759	hsa-miR-4282	CLIP-seq
MIRT2631760	hsa-miR-4290	CLIP-seq
MIRT2338152	hsa-miR-4424	CLIP-seq
MIRT2631761	hsa-miR-4476	CLIP-seq
MIRT2631762	hsa-miR-4651	CLIP-seq
MIRT2631763	hsa-miR-4664-5p	CLIP-seq
MIRT2631764	hsa-miR-4710	CLIP-seq
MIRT2631765	hsa-miR-4719	CLIP-seq
MIRT2631766	hsa-miR-4772-5p	CLIP-seq
MIRT2631767	hsa-miR-4789-3p	CLIP-seq
MIRT2631768	hsa-miR-4792	CLIP-seq
MIRT2631769	hsa-miR-513b	CLIP-seq
MIRT2631770	hsa-miR-549	CLIP-seq
MIRT2631771	hsa-miR-608	CLIP-seq
MIRT2631772	hsa-miR-642b	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
EGR1	Unknown	21826097
EGR3	Unknown	21826097

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000132	Process	Establishment of mitotic spindle orientation	IEA
GO:0001656	Process	Metanephros development	IEA
GO:0001657	Process	Ureteric bud development	IEA
GO:0001759	Process	Organ induction	IEA
GO:0005515	Function	Protein binding	IPI	21988832, 23088713, 25416956, 31515488, 32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0009966	Process	Regulation of signal transduction	IEA
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	IEA
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	ISS
GO:0016020	Component	Membrane	IEA
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IEA
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	ISS
GO:0040037	Process	Negative regulation of fibroblast growth factor receptor signaling pathway	IBA
GO:0040037	Process	Negative regulation of fibroblast growth factor receptor signaling pathway	IEA
GO:0040037	Process	Negative regulation of fibroblast growth factor receptor signaling pathway	IMP	16481357
GO:0046580	Process	Negative regulation of Ras protein signal transduction	IBA
GO:0046580	Process	Negative regulation of Ras protein signal transduction	IEA
GO:0048513	Process	Animal organ development	IBA
GO:0051387	Process	Negative regulation of neurotrophin TRK receptor signaling pathway	IEA
GO:0060449	Process	Bud elongation involved in lung branching	IEA
GO:0060940	Process	Epithelial to mesenchymal transition involved in cardiac fibroblast development	IEA
GO:0060940	Process	Epithelial to mesenchymal transition involved in cardiac fibroblast development	ISS
GO:0070371	Process	ERK1 and ERK2 cascade	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IBA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	ISS
GO:1902747	Process	Negative regulation of lens fiber cell differentiation	IEA
GO:1902747	Process	Negative regulation of lens fiber cell differentiation	ISS

Other IDs

• MIM: 602465
• HGNC: 11269
• e!Ensembl: ENSG00000164056

Protein

• UniProt ID: O43609
• Protein name: Protein sprouty homolog 1 (Spry-1)
• Protein function: Inhibits fibroblast growth factor (FGF)-induced retinal lens fiber differentiation, probably by inhibiting FGF-mediated phosphorylation of ERK1/2 (By similarity). Inhibits TGFB-induced epithelial-to-mesenchymal transition in lens epithelial cell
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05210	Sprouty	186 → 298	Sprouty protein (Spry)	Family

• Sequence:

  MDPQNQHGSGSSLVVIQQPSLDSRQRLDYEREIQPTAILSLDQIKAIRGSNEYTEGPSVV
  KRPAPRTAPRQEKHERTHEIIPINVNNNYEHRHTSHLGHAVLPSNARGPILSRSTSTGSA
  ASSGSNSSASSEQGLLGRSPPTRPVPGHRSERAIRTQPKQLIVDDLKGSLKEDLTQHKFI
  CEQCGKCKCGECTAPRTLPSCLACNRQCLCSAESMVEYGTCMCLVKGIFYHCSNDDEGDS
  YSDNPCSCSQSHCCSRYLCMGAMSLFLPCLLCYPPAKGCLKLCRRCYDWIHRPGCRCKNS
  NTVYCKLESCPSRGQGKPS

• Sequence length: 319

Pathways

Reactome:

EGFR downregulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CRANIOSYNOSTOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELVIC ORGAN PROLAPSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPRY1-related disorder	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	17312329		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	17312329		★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	20068162		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29398368		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29398368		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	29096943, 30203914		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15342396, 20696135, 26976794		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24510305	Inhibit	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	30459472	Inhibit	★☆☆☆☆ Found in Text Mining only
C-cell hyperplasia of thyroid	Thyroid Hyperplasia	BEFREE	22158037		★☆☆☆☆ Found in Text Mining only
Cakut	Congenital anomalies of kidney and urinary tract	BEFREE	30987821		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35394843	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	17717605	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36035369	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	25032869, 25533808		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	24804616		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	20560046		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	27677077		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	27677077		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	17312329		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	21932411		★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	30273098	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	20813052		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26434583		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	34873417	Associate	★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	24980605		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	30126987		★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	Pubtator	33172359	Associate	★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	BEFREE	20068162		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	25533808		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	37832554	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	27375017		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	29228449	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29734672		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29228449, 29734672		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29316313		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	29316313	Associate	★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	22729463	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	21385932	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	34957932	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21932411		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	21932411		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15342396, 20696135, 26976794		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25032869		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21826097, 22880013, 24604720		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21826097, 24270409		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	27677077		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	22158037		★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	32444628	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	35394843	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20068162, 20813052, 21385932, 21826097, 22158037, 24270409, 27375017		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	21826097		★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	19443465		★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	BEFREE	19443465		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	19443465		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	23146288		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	31138786	Associate	★☆☆☆☆ Found in Text Mining only
Orofacial Cleft 1	Orofacial cleft	Pubtator	26561393, 28232668	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	35196925	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	23146288		★☆☆☆☆ Found in Text Mining only
Otofaciocervical Syndrome	Otofaciocervical syndrome	Pubtator	26561393	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	25032869		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	27692691		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	35933226	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16954433, 21826097, 22880013, 24604720		★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid tumor	Pubtator	27941797	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	20068162		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28098403, 31646548		★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	23527175	Associate	★☆☆☆☆ Found in Text Mining only
Torsades de Pointes	Torsades de pointes	Pubtator	33664309	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	26976794		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	27677077	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	27677077	Stimulate	★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	31701684	Associate	★☆☆☆☆ Found in Text Mining only