Gene Gene information from NCBI Gene database.
Entrez ID 10251
Gene name Sprouty RTK signaling antagonist 3
Gene symbol SPRY3
Synonyms (NCBI Gene)
spry-3
Chromosome X|Y
Chromosome location Xq28 and Yq12
miRNA miRNA information provided by mirtarbase database.
376
miRTarBase ID miRNA Experiments Reference
MIRT044518 hsa-miR-320a CLASH 23622248
MIRT622119 hsa-miR-7110-3p HITS-CLIP 23824327
MIRT622117 hsa-miR-6873-3p HITS-CLIP 23824327
MIRT622119 hsa-miR-7110-3p HITS-CLIP 23824327
MIRT622118 hsa-miR-130b-5p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 17974561, 29293652, 32296183
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol IBA
GO:0007399 Process Nervous system development IEA
GO:0009966 Process Regulation of signal transduction IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300531 11271 ENSG00000168939
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O43610
Protein name Protein sprouty homolog 3 (Spry-3) (Sprouty RTK signaling antagonist 3) (Sprouty3)
Protein function Inhibits neurite branching, arbor length and neurite complexity (By similarity). Inhibits EGF-mediated p42/44 ERK signaling (By similarity). Negatively regulates the MAPK cascade, resulting in a reduction of extracellular matrix protein accumula
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05210 Sprouty 152 263 Sprouty protein (Spry) Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed; particularly in the fetal tissues. Expressed in the brain with expression the highest in Purkinje cells in the cerebellum (at protein level) (PubMed:26089202). Expressed in the myocardium of the heart (PubMed:30878395
Sequence
MDAAVTDDFQQILPIEQLRSTHASNDYVERPPAPCKQALSSPSLIVQTHKSDWSLATMPT
SLPRSLSQCHQLQPLPQHLSQSSIASSMSHSTTASDQRLLASITPSPSGQSIIRTQPGAG
VHPKADGALKGEAEQSAGHPSEHLFICEECGRCKCVPCTAARPLPSCWLCNQRCLCSAES
LLDYGTCLCCVKGLFYHCSTDDEDNCADEPCSCGPSSCFVRWAAMSLISLFLPCLCCYLP
TRGCLHLCQQGYDSLRRPGCRCK
RHTNTVCRKISSGSAPFPKAQEKSV
Sequence length 288
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Ependymoma Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
IDIOPATHIC OSTEONECROSIS OF THE FEMORAL HEAD GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Autistic Disorder Autism BEFREE 26089202
★☆☆☆☆
Found in Text Mining only
Brain Neoplasms Brain neoplasms Pubtator 31374860 Associate
★☆☆☆☆
Found in Text Mining only
Cerebral Infarction Ischemic stroke Pubtator 22365286 Associate
★☆☆☆☆
Found in Text Mining only
Cleft Palate Cleft palate Pubtator 30273098 Associate
★☆☆☆☆
Found in Text Mining only
Glioblastoma Glioblastoma BEFREE 31374860
★☆☆☆☆
Found in Text Mining only
Glioblastoma Glioblastoma Pubtator 31374860 Associate
★☆☆☆☆
Found in Text Mining only
Glioblastoma Multiforme Glioblastoma BEFREE 31374860
★☆☆☆☆
Found in Text Mining only
Leukemia Myeloid Acute Myeloid leukemia Pubtator 28625976 Inhibit
★☆☆☆☆
Found in Text Mining only
Myopathy Central Core Central core myopathy Pubtator 38582058 Associate
★☆☆☆☆
Found in Text Mining only
Neoplasms Neoplasms BEFREE 21932411
★☆☆☆☆
Found in Text Mining only