CDK9 (cyclin dependent kinase 9)

Gene

• Entrez ID: 1025
• Gene name: Cyclin dependent kinase 9
• Gene symbol: CDK9
• Synonyms (NCBI Gene): C-2k, CDC2L4, CTK1, PITALRE, TAK
• Chromosome: 9
• Chromosome location: 9q34.11
• Summary: The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of S. cerevisiae cdc28, and S. pombe cdc2, and known as important cell cycle regulators. This kina

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000389	hsa-miR-1-3p	Proteomics	18668040
MIRT031696	hsa-miR-16-5p	Proteomics	18668040
MIRT049212	hsa-miR-92a-3p	CLASH	23622248
MIRT041575	hsa-miR-193b-3p	CLASH	23622248
MIRT437914	hsa-miR-874-3p	Luciferase reporter assay, Western blot	25281924
MIRT437914	hsa-miR-874-3p	Luciferase reporter assay, Western blot	25281924
MIRT684291	hsa-miR-8080	HITS-CLIP	23313552
MIRT684290	hsa-miR-371b-3p	HITS-CLIP	23313552
MIRT684289	hsa-miR-4691-3p	HITS-CLIP	23313552
MIRT625848	hsa-miR-6736-3p	HITS-CLIP	23313552
MIRT684288	hsa-miR-1825	HITS-CLIP	23313552
MIRT684287	hsa-miR-199a-5p	HITS-CLIP	23313552
MIRT684286	hsa-miR-199b-5p	HITS-CLIP	23313552
MIRT684285	hsa-miR-4667-3p	HITS-CLIP	23313552
MIRT684284	hsa-miR-660-3p	HITS-CLIP	23313552
MIRT625847	hsa-miR-6787-3p	HITS-CLIP	23313552
MIRT684283	hsa-miR-3925-3p	HITS-CLIP	23313552
MIRT684282	hsa-miR-3663-5p	HITS-CLIP	23313552
MIRT684281	hsa-miR-4290	HITS-CLIP	23313552
MIRT684280	hsa-miR-6895-3p	HITS-CLIP	23313552
MIRT684279	hsa-miR-3157-5p	HITS-CLIP	23313552
MIRT684278	hsa-miR-6843-3p	HITS-CLIP	23313552
MIRT684277	hsa-miR-6848-3p	HITS-CLIP	23313552
MIRT618912	hsa-miR-5000-5p	HITS-CLIP	23824327
MIRT618911	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT625848	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT618910	hsa-miR-4485-5p	HITS-CLIP	23824327
MIRT618909	hsa-miR-1281	HITS-CLIP	23824327
MIRT618908	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT625847	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT618907	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT618905	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT618904	hsa-miR-1297	HITS-CLIP	23824327
MIRT618903	hsa-miR-26a-5p	HITS-CLIP	23824327
MIRT618902	hsa-miR-26b-5p	HITS-CLIP	23824327
MIRT618901	hsa-miR-4465	HITS-CLIP	23824327
MIRT638899	hsa-miR-4282	HITS-CLIP	23824327
MIRT638893	hsa-miR-550b-3p	HITS-CLIP	23824327
MIRT618912	hsa-miR-5000-5p	HITS-CLIP	23824327
MIRT618911	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT625848	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT618910	hsa-miR-4485-5p	HITS-CLIP	23824327
MIRT618909	hsa-miR-1281	HITS-CLIP	23824327
MIRT618908	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT618907	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT618912	hsa-miR-5000-5p	HITS-CLIP	23824327
MIRT618911	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT625848	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT618910	hsa-miR-4485-5p	HITS-CLIP	23824327
MIRT618909	hsa-miR-1281	HITS-CLIP	23824327
MIRT618908	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT625847	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT618907	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT618905	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT618904	hsa-miR-1297	HITS-CLIP	23824327
MIRT618903	hsa-miR-26a-5p	HITS-CLIP	23824327
MIRT618902	hsa-miR-26b-5p	HITS-CLIP	23824327
MIRT618901	hsa-miR-4465	HITS-CLIP	23824327
MIRT638899	hsa-miR-4282	HITS-CLIP	23824327
MIRT638898	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT638897	hsa-miR-340-3p	HITS-CLIP	23824327
MIRT638896	hsa-miR-6827-3p	HITS-CLIP	23824327
MIRT638895	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT638894	hsa-miR-5695	HITS-CLIP	23824327
MIRT638893	hsa-miR-550b-3p	HITS-CLIP	23824327
MIRT638892	hsa-miR-515-5p	HITS-CLIP	23824327
MIRT638891	hsa-miR-519e-5p	HITS-CLIP	23824327
MIRT618912	hsa-miR-5000-5p	HITS-CLIP	23824327
MIRT618911	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT625848	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT618910	hsa-miR-4485-5p	HITS-CLIP	23824327
MIRT618909	hsa-miR-1281	HITS-CLIP	23824327
MIRT618908	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT625847	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT618907	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT618906	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT618905	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT618912	hsa-miR-5000-5p	HITS-CLIP	23824327
MIRT618911	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT618910	hsa-miR-4485-5p	HITS-CLIP	23824327
MIRT618909	hsa-miR-1281	HITS-CLIP	23824327
MIRT618908	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT618907	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT618906	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT618905	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT618904	hsa-miR-1297	HITS-CLIP	23824327
MIRT618903	hsa-miR-26a-5p	HITS-CLIP	23824327
MIRT618902	hsa-miR-26b-5p	HITS-CLIP	23824327
MIRT618901	hsa-miR-4465	HITS-CLIP	23824327
MIRT684291	hsa-miR-8080	HITS-CLIP	23313552
MIRT684290	hsa-miR-371b-3p	HITS-CLIP	23313552
MIRT684289	hsa-miR-4691-3p	HITS-CLIP	23313552
MIRT625848	hsa-miR-6736-3p	HITS-CLIP	23313552
MIRT684288	hsa-miR-1825	HITS-CLIP	23313552
MIRT684287	hsa-miR-199a-5p	HITS-CLIP	23313552
MIRT684286	hsa-miR-199b-5p	HITS-CLIP	23313552
MIRT684285	hsa-miR-4667-3p	HITS-CLIP	23313552
MIRT684284	hsa-miR-660-3p	HITS-CLIP	23313552
MIRT625847	hsa-miR-6787-3p	HITS-CLIP	23313552
MIRT684283	hsa-miR-3925-3p	HITS-CLIP	23313552
MIRT684282	hsa-miR-3663-5p	HITS-CLIP	23313552
MIRT684281	hsa-miR-4290	HITS-CLIP	23313552
MIRT684280	hsa-miR-6895-3p	HITS-CLIP	23313552
MIRT684279	hsa-miR-3157-5p	HITS-CLIP	23313552
MIRT684278	hsa-miR-6843-3p	HITS-CLIP	23313552
MIRT684277	hsa-miR-6848-3p	HITS-CLIP	23313552
MIRT618912	hsa-miR-5000-5p	HITS-CLIP	23824327
MIRT618911	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT625848	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT618910	hsa-miR-4485-5p	HITS-CLIP	23824327
MIRT618909	hsa-miR-1281	HITS-CLIP	23824327
MIRT618908	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT625847	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT618907	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT618905	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT618904	hsa-miR-1297	HITS-CLIP	23824327
MIRT618903	hsa-miR-26a-5p	HITS-CLIP	23824327
MIRT618902	hsa-miR-26b-5p	HITS-CLIP	23824327
MIRT618901	hsa-miR-4465	HITS-CLIP	23824327
MIRT638899	hsa-miR-4282	HITS-CLIP	23824327
MIRT638893	hsa-miR-550b-3p	HITS-CLIP	23824327
MIRT618912	hsa-miR-5000-5p	HITS-CLIP	23824327
MIRT618911	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT625848	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT618910	hsa-miR-4485-5p	HITS-CLIP	23824327
MIRT618909	hsa-miR-1281	HITS-CLIP	23824327
MIRT618908	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT618907	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT618912	hsa-miR-5000-5p	HITS-CLIP	23824327
MIRT618911	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT625848	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT618910	hsa-miR-4485-5p	HITS-CLIP	23824327
MIRT618909	hsa-miR-1281	HITS-CLIP	23824327
MIRT618908	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT625847	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT618907	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT618905	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT618904	hsa-miR-1297	HITS-CLIP	23824327
MIRT618903	hsa-miR-26a-5p	HITS-CLIP	23824327
MIRT618902	hsa-miR-26b-5p	HITS-CLIP	23824327
MIRT618901	hsa-miR-4465	HITS-CLIP	23824327
MIRT638899	hsa-miR-4282	HITS-CLIP	23824327
MIRT638898	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT638897	hsa-miR-340-3p	HITS-CLIP	23824327
MIRT638896	hsa-miR-6827-3p	HITS-CLIP	23824327
MIRT638895	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT638894	hsa-miR-5695	HITS-CLIP	23824327
MIRT638893	hsa-miR-550b-3p	HITS-CLIP	23824327
MIRT638892	hsa-miR-515-5p	HITS-CLIP	23824327
MIRT638891	hsa-miR-519e-5p	HITS-CLIP	23824327
MIRT618912	hsa-miR-5000-5p	HITS-CLIP	23824327
MIRT618911	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT625848	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT618910	hsa-miR-4485-5p	HITS-CLIP	23824327
MIRT618909	hsa-miR-1281	HITS-CLIP	23824327
MIRT618908	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT625847	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT618907	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT618906	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT618905	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT618912	hsa-miR-5000-5p	HITS-CLIP	23824327
MIRT618911	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT618910	hsa-miR-4485-5p	HITS-CLIP	23824327
MIRT618909	hsa-miR-1281	HITS-CLIP	23824327
MIRT618908	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT618907	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT618906	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT618905	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT618904	hsa-miR-1297	HITS-CLIP	23824327
MIRT618903	hsa-miR-26a-5p	HITS-CLIP	23824327
MIRT618902	hsa-miR-26b-5p	HITS-CLIP	23824327
MIRT618901	hsa-miR-4465	HITS-CLIP	23824327
MIRT881486	hsa-miR-1200	CLIP-seq
MIRT881487	hsa-miR-1292	CLIP-seq
MIRT881488	hsa-miR-1912	CLIP-seq
MIRT881489	hsa-miR-1915	CLIP-seq
MIRT881490	hsa-miR-3126-5p	CLIP-seq
MIRT881491	hsa-miR-3130-5p	CLIP-seq
MIRT881492	hsa-miR-3192	CLIP-seq
MIRT881493	hsa-miR-3926	CLIP-seq
MIRT881494	hsa-miR-4274	CLIP-seq
MIRT881495	hsa-miR-4314	CLIP-seq
MIRT881496	hsa-miR-4324	CLIP-seq
MIRT881497	hsa-miR-4419a	CLIP-seq
MIRT881498	hsa-miR-4450	CLIP-seq
MIRT881499	hsa-miR-4471	CLIP-seq
MIRT881500	hsa-miR-4482	CLIP-seq
MIRT881501	hsa-miR-4510	CLIP-seq
MIRT881502	hsa-miR-4530	CLIP-seq
MIRT881503	hsa-miR-4646-5p	CLIP-seq
MIRT881504	hsa-miR-4649-3p	CLIP-seq
MIRT881505	hsa-miR-4690-3p	CLIP-seq
MIRT881506	hsa-miR-4717-5p	CLIP-seq
MIRT881507	hsa-miR-491-5p	CLIP-seq
MIRT881508	hsa-miR-544b	CLIP-seq
MIRT881509	hsa-miR-548aa	CLIP-seq
MIRT881510	hsa-miR-622	CLIP-seq
MIRT881511	hsa-miR-634	CLIP-seq
MIRT1961133	hsa-miR-124	CLIP-seq
MIRT1961134	hsa-miR-1262	CLIP-seq
MIRT881489	hsa-miR-1915	CLIP-seq
MIRT1961135	hsa-miR-214	CLIP-seq
MIRT1961136	hsa-miR-3125	CLIP-seq
MIRT881490	hsa-miR-3126-5p	CLIP-seq
MIRT1961137	hsa-miR-3148	CLIP-seq
MIRT1961138	hsa-miR-3202	CLIP-seq
MIRT1961139	hsa-miR-3619-5p	CLIP-seq
MIRT1961140	hsa-miR-3649	CLIP-seq
MIRT1961141	hsa-miR-3916	CLIP-seq
MIRT1961142	hsa-miR-4261	CLIP-seq
MIRT881498	hsa-miR-4450	CLIP-seq
MIRT1961143	hsa-miR-4533	CLIP-seq
MIRT1961144	hsa-miR-4660	CLIP-seq
MIRT1961145	hsa-miR-4690-5p	CLIP-seq
MIRT1961146	hsa-miR-4701-3p	CLIP-seq
MIRT1961147	hsa-miR-4763-5p	CLIP-seq
MIRT1961148	hsa-miR-4768-5p	CLIP-seq
MIRT881507	hsa-miR-491-5p	CLIP-seq
MIRT1961149	hsa-miR-492	CLIP-seq
MIRT1961150	hsa-miR-506	CLIP-seq
MIRT1961151	hsa-miR-596	CLIP-seq
MIRT1961152	hsa-miR-646	CLIP-seq
MIRT1961153	hsa-miR-761	CLIP-seq
MIRT1961154	hsa-miR-766	CLIP-seq
MIRT2197919	hsa-miR-1	CLIP-seq
MIRT2197920	hsa-miR-125a-3p	CLIP-seq
MIRT2197921	hsa-miR-1266	CLIP-seq
MIRT2197922	hsa-miR-206	CLIP-seq
MIRT2197923	hsa-miR-3664-3p	CLIP-seq
MIRT2197924	hsa-miR-3934	CLIP-seq
MIRT2197925	hsa-miR-4518	CLIP-seq
MIRT2197926	hsa-miR-508-5p	CLIP-seq
MIRT2197927	hsa-miR-542-3p	CLIP-seq
MIRT2197928	hsa-miR-548g	CLIP-seq
MIRT2197929	hsa-miR-613	CLIP-seq
MIRT2197930	hsa-miR-764	CLIP-seq
MIRT2385872	hsa-miR-3688-3p	CLIP-seq
MIRT2501145	hsa-miR-3667-5p	CLIP-seq
MIRT2501146	hsa-miR-4679	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0001223	Function	Transcription coactivator binding	IPI	12037672
GO:0003677	Function	DNA binding	IDA	16109376
GO:0003682	Function	Chromatin binding	IEA
GO:0003682	Function	Chromatin binding	ISS
GO:0003711	Function	Transcription elongation factor activity	IDA	14580347
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	TAS	8170997
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	14701750, 16427012, 28431135, 29335245
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	IBA
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	IDA	12037670, 14701750
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	IEA
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	TAS	10866664
GO:0005515	Function	Protein binding	IPI	9499409, 12832472, 14580347, 15107825, 15286705, 15563843, 15713662, 16331689, 17690245, 18281698, 18483487, 18566585, 19387490, 19914168, 20153263, 20535204, 20562857, 20930849, 21533037, 21729782, 22190034, 22939624, 22959624, 23455922, 23602568, 24189400, 24360279, 24981860, 2503
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	14701750, 29849146
GO:0005634	Component	Nucleus	IDA	9499409, 16109376
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0006281	Process	DNA repair	IEA
GO:0006282	Process	Regulation of DNA repair	IDA	20493174
GO:0006366	Process	Transcription by RNA polymerase II	IDA	9852112
GO:0006366	Process	Transcription by RNA polymerase II	IDA	28426094
GO:0006366	Process	Transcription by RNA polymerase II	TAS	29849146
GO:0006367	Process	Transcription initiation at RNA polymerase II promoter	TAS	10866664
GO:0006368	Process	Transcription elongation by RNA polymerase II	IDA	9852112
GO:0006368	Process	Transcription elongation by RNA polymerase II	IDA	14580347, 16427012
GO:0006368	Process	Transcription elongation by RNA polymerase II	TAS	10866664
GO:0006468	Process	Protein phosphorylation	IDA	16109376
GO:0006974	Process	DNA damage response	IEA
GO:0007346	Process	Regulation of mitotic cell cycle	IMP	19575011
GO:0008023	Component	Transcription elongation factor complex	IDA	22195968
GO:0008023	Component	Transcription elongation factor complex	TAS	10866664
GO:0008024	Component	Cyclin/CDK positive transcription elongation factor complex	IDA	9499409, 15905409
GO:0008024	Component	Cyclin/CDK positive transcription elongation factor complex	IEA
GO:0008024	Component	Cyclin/CDK positive transcription elongation factor complex	IPI	9499409, 18566585
GO:0008283	Process	Cell population proliferation	TAS	8170997
GO:0008353	Function	RNA polymerase II CTD heptapeptide repeat kinase activity	IBA
GO:0008353	Function	RNA polymerase II CTD heptapeptide repeat kinase activity	IDA	9499409, 12721286, 28426094
GO:0008353	Function	RNA polymerase II CTD heptapeptide repeat kinase activity	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016301	Function	Kinase activity	IDA	22959624
GO:0016301	Function	Kinase activity	IEA
GO:0016605	Component	PML body	IDA	18250157
GO:0016605	Component	PML body	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0017069	Function	SnRNA binding	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0031297	Process	Replication fork processing	IDA	20930849
GO:0031440	Process	Regulation of mRNA 3'-end processing	IEA
GO:0031440	Process	Regulation of mRNA 3'-end processing	IMP	19575011
GO:0032968	Process	Positive regulation of transcription elongation by RNA polymerase II	IBA
GO:0032968	Process	Positive regulation of transcription elongation by RNA polymerase II	IDA	9499409, 14701750, 30134174
GO:0034244	Process	Negative regulation of transcription elongation by RNA polymerase II	IDA	27256882
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA
GO:0043923	Process	Host-mediated activation of viral transcription	IDA	10866664
GO:0043923	Process	Host-mediated activation of viral transcription	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	29335245
GO:0051147	Process	Regulation of muscle cell differentiation	IMP	12037670
GO:0051647	Process	Nucleus localization	IDA	12942536
GO:0051726	Process	Regulation of cell cycle	IDA	20930849
GO:0070691	Component	P-TEFb complex	IDA	18483487, 30134174
GO:0071345	Process	Cellular response to cytokine stimulus	IDA	17956865
GO:0097322	Function	7SK snRNA binding	IDA	11713533
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0120186	Process	Negative regulation of protein localization to chromatin	IDA	14701750
GO:0120187	Process	Positive regulation of protein localization to chromatin	IDA	29335245
GO:0140673	Process	Transcription elongation-coupled chromatin remodeling	IDA	19844166
GO:0160239	Process	Transcription pausing by RNA polymerase II	IDA	14701750, 27256882

Other IDs

• MIM: 603251
• HGNC: 1780
• e!Ensembl: ENSG00000136807

Protein

• UniProt ID: P50750
• Protein name: Cyclin-dependent kinase 9 (EC 2.7.11.22) (EC 2.7.11.23) (C-2K) (Cell division cycle 2-like protein kinase 4) (Cell division protein kinase 9) (Serine/threonine-protein kinase PITALRE) (Tat-associated kinase complex catalytic subunit)
• Protein function: Protein kinase involved in the regulation of transcription (PubMed:10574912, PubMed:10757782, PubMed:11145967, PubMed:11575923, PubMed:11809800, PubMed:11884399, PubMed:14701750, PubMed:16109376, PubMed:16109377, PubMed:20930849, PubMed:28426094
• PDB: 3BLH, 3BLQ, 3BLR, 3LQ5, 3MI9, 3MIA, 3MY1, 3TN8, 3TNH, 3TNI, 4BCF, 4BCG, 4BCH, 4BCI, 4BCJ, 4EC8, 4EC9, 4IMY, 4OGR, 4OR5, 5L1Z, 6CYT, 6GZH, 6W9E, 6Z45, 7NWK, 8I0L, 8K5R
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	19 → 315	Protein kinase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous.
• Sequence:

  MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFP
  ITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVK
  FTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNS
  QPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLAL
  ISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDP
  AQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNP
  ATTNQTEFERVF

• Sequence length: 372

Pathways

KEGG:

Viral life cycle - HIV-1
Transcriptional misregulation in cancer

Reactome:

Formation of RNA Pol II elongation complex
Formation of HIV-1 elongation complex containing HIV-1 Tat
Interactions of Tat with host cellular proteins
SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription
RNA Polymerase II Pre-transcription Events
TP53 Regulates Transcription of DNA Repair Genes
RNA polymerase II transcribes snRNA genes
RNA Polymerase II Transcription Elongation
Estrogen-dependent gene expression

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CDK9-related disorder	Likely benign; Uncertain significance; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY BREAST CARCINOMA	—	GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEDULLOBLASTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	29464016		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	29348128, 29491412, 30361682		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	28404924, 31384313, 31384397		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	29464016		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	29269870, 31289198		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	31594641		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	28646117		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	28763002		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26934555		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	26636538		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	31085699		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	31588340		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	15753651		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	20930849	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	26636538		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	26636538	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	31085699		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	28179288		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	28404924		★☆☆☆☆ Found in Text Mining only
Basal Ganglia Diseases	Basal Ganglia Diseases	BEFREE	29318783		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	31160383		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	29254993		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24309997, 25281924, 31262335, 31535397		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24309997, 25281924, 26812885	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	34011401	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28940993, 30637779, 37247228	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	31160383		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	34011401	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	31311847	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37884683	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	15297879		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29441926		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	26636538	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	33640901	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	31432179		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30536701		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30536701		★☆☆☆☆ Found in Text Mining only
CHARGE Syndrome	Charge syndrome	Pubtator	33640901	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	29464016		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	31594641		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	30664779	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30209133		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21768328, 27888629, 29899864		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	28796496, 29093293, 29318783, 30089885, 31299348		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30121880		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	35660024	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29063678, 31788079		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	30425131		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26439693, 29402316, 29508166, 30387230, 31398271		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	15297879, 15514168, 30092100		★☆☆☆☆ Found in Text Mining only
Contracture	Contracture	Pubtator	33640901	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	26636538	Stimulate	★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	27650277		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	31307784		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28108665, 30243991, 30289550		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	29269870, 30617217, 31243099, 31289198		★☆☆☆☆ Found in Text Mining only
Duane Retraction Syndrome	Duane retraction syndrome	Pubtator	33640901	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	32901849, 37363949	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma-primitive neuroectodermal tumor (PNET)	Ewing sarcoma	BEFREE	15753651		★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	28404924, 31384313		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	29448843		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	28188407		★☆☆☆☆ Found in Text Mining only
Gastrointestinal carcinoma	Gastrointestinal carcinoma	BEFREE	28494535		★☆☆☆☆ Found in Text Mining only
Generalized pustular psoriasis	Pustular Psoriasis	BEFREE	28196704		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	28318829, 31741857		★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	31421135, 31626797		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22391209, 29254993		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24886624, 37551745	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22391209, 29254993		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	15297879, 15514168, 30092100		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	24688048, 30135222, 31827241, 31843752		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	38117531	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary gingival fibromatosis	Hereditary Gingival Fibromatosis	BEFREE	20716641		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	21385932	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	27811172		★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	31782769		★☆☆☆☆ Found in Text Mining only
Hypersomnia	Hypersomnia	BEFREE	31654653		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	29369782		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29318783, 29440309, 30089885, 31299348		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	30972425		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	35660024	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	29908959		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	15258998		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	29845723		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28978536, 29902463		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	25596730, 30253346		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	25596730	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	31253180	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	23775716, 26627013, 28892104, 29348128, 29471852, 29491412, 30132679, 30194564, 30361682, 30587525, 30699367, 31238183, 31612739		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17956865, 25128497, 28940993, 29429148, 30637779		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	25128497		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	23596302		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31294695	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	35119000	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	15258998, 31827241		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	37882668	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	31202810		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24309997, 25281924, 26812885, 28636052, 30930249, 31262335, 31535397		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28231737, 31311847		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	22391209, 27582311, 29355559, 31151054, 31429205		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28701053		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	31160383		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12432243, 19029809, 22391209, 24362439, 24495868, 24688048, 25596730, 26503893, 26573875, 26766294, 27662623, 27765652, 27833949, 27847320, 28179288, 28490463, 28494535, 28636052, 28722178, 28961375, 29251720, 29334375, 29402316, 29434052, 29702148, 30135222, 30362418, 30454645, 30488489, 30579871, 30647871, 30826127, 30930249, 31005255, 31151054, 31376566, 31402912, 31603123, 31786654, 31788079, 31827241, 31843752, 7882308		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30536701		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	29063678, 31788079		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17998334		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	23075291		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	30135308		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	31594641		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	BEFREE	21358262, 27650277, 29063678		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	33745909, 38243078	Associate	★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	22798288		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	28938651, 29329658, 30737236		★☆☆☆☆ Found in Text Mining only
Narcolepsy type 1	Narcolepsy	BEFREE	31654653		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12097285, 15753651, 15958589, 19155524, 20716641, 24398428, 25501576, 26439693, 26503893, 26573875, 27417125, 28231737, 28601972, 29355559, 29370189, 29402316, 29712686, 29728518, 30135222, 30135308, 30387230, 30425131, 30454645, 31160383, 31527550, 31594641, 31788079, 7882308		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	15753651, 27378523		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	LHGDN	15753651		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	15753651, 27517323, 33016930	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28763002		★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	15753651		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	20716641, 31376566		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	29318783		★☆☆☆☆ Found in Text Mining only
NUT midline carcinoma	Carcinoma	BEFREE	24518598, 28630312, 28930680		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	26812885		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	29773986		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29725464, 30579871		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	30579871	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25277198, 30726104	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28231737, 31311847		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	28231737, 31311847	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	31452696, 31758083		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	22391209, 27582311, 29355559, 31151054, 31429205		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	29580912		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31151054, 32611550, 33932081, 34592899, 35708495	Associate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	29318783		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	28859059		★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid Tumor	BEFREE	29156698		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	30488489		★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	30488489	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	29318783, 29345044, 29440309, 30190165, 31773211		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	31788079		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	19563534		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	29755650		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	26573875, 27847320, 30341788		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the hypopharynx	Hypopharyngeal Carcinoma	BEFREE	27847320		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28701053		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28701053	Associate	★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	30488489		★☆☆☆☆ Found in Text Mining only
Telangiectasia Hereditary Hemorrhagic	Hereditary hemorrhagic telangiectasia	Pubtator	24267784	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	30135308	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	35119000	Associate	★☆☆☆☆ Found in Text Mining only
Transient Myeloproliferative Disorder of Down Syndrome	Transient Myeloproliferative Disorder Of Down Syndrome	BEFREE	18780834		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30647871, 31262335		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	31262335	Associate	★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	31202810		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	36374405	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	36399280	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	27650277		★☆☆☆☆ Found in Text Mining only