GLYAT (glycine-N-acyltransferase)

Gene

• Entrez ID: 10249
• Gene name: Glycine-N-acyltransferase
• Gene symbol: GLYAT
• Synonyms (NCBI Gene): ACGNAT, CAT, GAT
• Chromosome: 11
• Chromosome location: 11q12.1
• Summary: The glycine-N-acyltransferase protein conjugates glycine with acyl-CoA substrates in the mitochondria. The protein is thought to be important in the detoxification of endogenous and xenobiotic acyl-CoA`s. Two transcript variants encoding different isoform

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT678465	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT679250	hsa-miR-5693	HITS-CLIP	23824327
MIRT678464	hsa-miR-4485-5p	HITS-CLIP	23824327
MIRT678463	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT678462	hsa-miR-1539	HITS-CLIP	23824327
MIRT678461	hsa-miR-3193	HITS-CLIP	23824327
MIRT678460	hsa-miR-1281	HITS-CLIP	23824327
MIRT678459	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT678458	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT678457	hsa-miR-1976	HITS-CLIP	23824327
MIRT678456	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT678455	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT678454	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT678453	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT678452	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT678451	hsa-miR-4284	HITS-CLIP	23824327
MIRT679249	hsa-miR-891a-3p	HITS-CLIP	23824327
MIRT678465	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT678464	hsa-miR-4485-5p	HITS-CLIP	23824327
MIRT678463	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT678462	hsa-miR-1539	HITS-CLIP	23824327
MIRT678461	hsa-miR-3193	HITS-CLIP	23824327
MIRT678460	hsa-miR-1281	HITS-CLIP	23824327
MIRT678459	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT678458	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT678457	hsa-miR-1976	HITS-CLIP	23824327
MIRT678456	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT678455	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT678454	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT678453	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT678452	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT678451	hsa-miR-4284	HITS-CLIP	23824327
MIRT678450	hsa-miR-498	HITS-CLIP	23824327
MIRT678465	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT679250	hsa-miR-5693	HITS-CLIP	23824327
MIRT678464	hsa-miR-4485-5p	HITS-CLIP	23824327
MIRT678463	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT678462	hsa-miR-1539	HITS-CLIP	23824327
MIRT678461	hsa-miR-3193	HITS-CLIP	23824327
MIRT678460	hsa-miR-1281	HITS-CLIP	23824327
MIRT678459	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT678458	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT678457	hsa-miR-1976	HITS-CLIP	23824327
MIRT678456	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT678455	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT678454	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT678453	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT678452	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT678451	hsa-miR-4284	HITS-CLIP	23824327
MIRT679249	hsa-miR-891a-3p	HITS-CLIP	23824327
MIRT678465	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT678464	hsa-miR-4485-5p	HITS-CLIP	23824327
MIRT678463	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT678462	hsa-miR-1539	HITS-CLIP	23824327
MIRT678461	hsa-miR-3193	HITS-CLIP	23824327
MIRT678460	hsa-miR-1281	HITS-CLIP	23824327
MIRT678459	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT678458	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT678457	hsa-miR-1976	HITS-CLIP	23824327
MIRT678456	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT678455	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT678454	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT678453	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT678452	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT678451	hsa-miR-4284	HITS-CLIP	23824327
MIRT678450	hsa-miR-498	HITS-CLIP	23824327
MIRT1022090	hsa-miR-1289	CLIP-seq
MIRT1022091	hsa-miR-142-5p	CLIP-seq
MIRT1022092	hsa-miR-185	CLIP-seq
MIRT1022093	hsa-miR-3149	CLIP-seq
MIRT1022094	hsa-miR-3198	CLIP-seq
MIRT1022095	hsa-miR-340	CLIP-seq
MIRT1022096	hsa-miR-4294	CLIP-seq
MIRT1022097	hsa-miR-4306	CLIP-seq
MIRT1022098	hsa-miR-4309	CLIP-seq
MIRT1022099	hsa-miR-4464	CLIP-seq
MIRT1022100	hsa-miR-4503	CLIP-seq
MIRT1022101	hsa-miR-4644	CLIP-seq
MIRT1022102	hsa-miR-4722-5p	CLIP-seq
MIRT1022103	hsa-miR-4748	CLIP-seq
MIRT1022104	hsa-miR-4768-3p	CLIP-seq
MIRT1022105	hsa-miR-494	CLIP-seq
MIRT1022106	hsa-miR-548m	CLIP-seq
MIRT1022107	hsa-miR-924	CLIP-seq
MIRT1022108	hsa-miR-1183	CLIP-seq
MIRT1022109	hsa-miR-1343	CLIP-seq
MIRT1022110	hsa-miR-28-5p	CLIP-seq
MIRT1022111	hsa-miR-3074-5p	CLIP-seq
MIRT1022112	hsa-miR-3139	CLIP-seq
MIRT1022113	hsa-miR-3690	CLIP-seq
MIRT1022114	hsa-miR-4254	CLIP-seq
MIRT1022115	hsa-miR-4733-5p	CLIP-seq
MIRT1022116	hsa-miR-4742-3p	CLIP-seq
MIRT1022117	hsa-miR-708	CLIP-seq
MIRT1022118	hsa-miR-889	CLIP-seq
MIRT2539805	hsa-miR-3689a-5p	CLIP-seq
MIRT2539806	hsa-miR-3689b	CLIP-seq
MIRT2539807	hsa-miR-3689e	CLIP-seq
MIRT2539808	hsa-miR-3689f	CLIP-seq
MIRT2539809	hsa-miR-513a-3p	CLIP-seq
MIRT2539810	hsa-miR-944	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	22475485
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	ISS
GO:0005739	Component	Mitochondrion	TAS	9202629
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0006544	Process	Glycine metabolic process	IBA
GO:0006544	Process	Glycine metabolic process	IDA	22475485
GO:0006544	Process	Glycine metabolic process	ISS
GO:0006637	Process	Acyl-CoA metabolic process	TAS	7802672
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0009636	Process	Response to toxic substance	IEA
GO:0009636	Process	Response to toxic substance	TAS	9202629
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0016746	Function	Acyltransferase activity	TAS	9202629
GO:0032787	Process	Monocarboxylic acid metabolic process	ISS
GO:0047961	Function	Glycine N-acyltransferase activity	IBA
GO:0047961	Function	Glycine N-acyltransferase activity	IDA	22475485
GO:0047961	Function	Glycine N-acyltransferase activity	IEA
GO:0047962	Function	Glycine N-benzoyltransferase activity	IBA
GO:0047962	Function	Glycine N-benzoyltransferase activity	IDA	22475485
GO:0047962	Function	Glycine N-benzoyltransferase activity	IEA
GO:0047962	Function	Glycine N-benzoyltransferase activity	ISS
GO:0047962	Function	Glycine N-benzoyltransferase activity	TAS
GO:1901787	Process	Benzoyl-CoA metabolic process	IDA	22475485

Other IDs

• MIM: 607424
• HGNC: 13734
• e!Ensembl: ENSG00000149124

Protein

• UniProt ID: Q6IB77
• Protein name: Glycine N-acyltransferase (EC 2.3.1.13) (Acyl-CoA:glycine N-acyltransferase) (AAc) (Aralkyl acyl-CoA N-acyltransferase) (Aralkyl acyl-CoA:amino acid N-acyltransferase) (Benzoyl-coenzyme A:glycine N-acyltransferase) (Glycine N-benzoyltransferase) (EC 2.3.1
• Protein function: Mitochondrial acyltransferase which transfers an acyl group to the N-terminus of glycine and glutamine, although much less efficiently. Can conjugate numerous substrates to form a variety of N-acylglycines, with a preference for benzoyl-CoA over
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF06021	Gly_acyl_tr_N	2 → 206	Aralkyl acyl-CoA:amino acid N-acyltransferase	Family
  PF08444	Gly_acyl_tr_C	207 → 295	Aralkyl acyl-CoA:amino acid N-acyltransferase, C-terminal region	Family

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in liver (at protein level) and kidney. Down-regulated in hepatocellular carcinoma and other liver cancers. {ECO:0000269|PubMed:22475485}.
• Sequence:

  MMLPLQGAQMLQMLEKSLRKSLPASLKVYGTVFHINHGNPFNLKAVVDKWPDFNTVVVCP
  QEQDMTDDLDHYTNTYQIYSKDPQNCQEFLGSPELINWKQHLQIQSSQPSLNEAIQNLAA
  IKSFKVKQTQRILYMAAETAKELTPFLLKSKILSPNGGKPKAINQEMFKLSSMDVTHAHL
  VNKFWHFGGNERSQRFIERCIQTFPTCCLLGPEGTPVCWDLMDQTGEMRMAGTLPEYRLH
  GLVTYVIYSHAQKLGKLGFPVYSHVDYSNEAMQKMSYTLQHVPIPRSWNQWNCVPL

• Sequence length: 296

Pathways

Reactome:

Conjugation of salicylate with glycine
Conjugation of benzoate with glycine

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acatalasemia	Acatalasia	Orphanet			★☆☆☆☆ Found in Text Mining only
Acatalasemia Japanese type	Acatalasia	CTD_human_DG	11001624, 11117918, 1551654, 2308162, 26074427		★☆☆☆☆ Found in Text Mining only
Acatalasemia Japanese type	Acatalasia	BEFREE	8673475		★☆☆☆☆ Found in Text Mining only
Acatalasemia Swiss type	Acatalasia	CTD_human_DG	11001624, 11117918, 1551654, 2308162, 26074427		★☆☆☆☆ Found in Text Mining only
Acatalasia	Acatalasia	BEFREE	11001624, 15771551, 15800961, 1962859, 1999334, 21947853, 23207165, 25772105, 30583218, 31827713, 3377795, 9237564, 9420149, 9564558		★☆☆☆☆ Found in Text Mining only
Acatalasia	Acatalasia	CTD_human_DG	11001624, 11117918, 1551654, 2308162, 26074427		★☆☆☆☆ Found in Text Mining only
Acatalasia	Acatalasia	ORPHANET_DG	11001624		★☆☆☆☆ Found in Text Mining only
Acatalasia	Acatalasia	Pubtator	14459853	Associate	★☆☆☆☆ Found in Text Mining only
Acatalasia	Acatalasia	GENOMICS_ENGLAND_DG	25772105, 27604308		★☆☆☆☆ Found in Text Mining only
Acoustic Neuroma	Acoustic Neuroma	BEFREE	18682580		★☆☆☆☆ Found in Text Mining only
Acute intermittent porphyria	Intermittent Porphyria	BEFREE	621286		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	28306688, 9373171		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	15131792		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	12447480		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	17409931, 27567474, 29702182		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	8332495		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	20097730		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	23290999		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	2892276		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy, Neonatal	Adrenoleukodystrophy	BEFREE	12851857, 2921319		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28306688, 9373171		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	2209540, 9324293		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	27935234, 31605749		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	9288786		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	29028686		★☆☆☆☆ Found in Text Mining only
alpha 1-Antitrypsin Deficiency	Alpha 1-Antitrypsin Deficiency	BEFREE	25028454, 28416015		★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	CTD_human_DG	19684199		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	18353692, 24817970, 30068908, 31370365, 37772794	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	10490274		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	23968537, 26919450, 29264389, 30946834		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	25054289, 28710685, 29218049, 30100896, 8731383		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	35627142	Associate	★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	BEFREE	16681429, 7719145		★☆☆☆☆ Found in Text Mining only
Amyotrophic lateral sclerosis 1	Amyotrophic lateral sclerosis	Pubtator	8731383	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	BEFREE	7719145		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	BEFREE	16681429, 8731383		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	27206672		★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	BEFREE	12604716		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	12604716, 9288786		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	30139350, 31827713		★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	23259718, 30010491, 32170816, 40657454	Inhibit	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	18849548, 28466542, 30010491, 31288760, 31506286		★☆☆☆☆ Found in Text Mining only
Angle Closure Glaucoma	Angle Closure Glaucoma	BEFREE	23961996		★☆☆☆☆ Found in Text Mining only
Aniridia	Aniridia	BEFREE	2575483, 2577871, 2988163, 3001710, 3013756, 6094051, 6273073, 6325323, 7106775		★☆☆☆☆ Found in Text Mining only
Aniridia	Aniridia	Pubtator	3001710	Associate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	28261616		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anthracosis	Anthracosis	BEFREE	12566517		★☆☆☆☆ Found in Text Mining only
Anthracosis	Anterior uveitis	Pubtator	12566517	Associate	★☆☆☆☆ Found in Text Mining only
Antisocial Personality Disorder	Antisocial Personality Disorder	BEFREE	29873521		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	29511963		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	29511963		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	31362375, 31583036		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	22694979	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	32273946, 40436996	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	29758327, 30351992		★☆☆☆☆ Found in Text Mining only
Aortic Diseases	Aortic Diseases	CTD_human_DG	25101153		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	19490052		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	9288786		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	15528470, 19409565, 21170678, 23055364, 29793330, 30599319		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	29852739, 31618993		★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	26924871	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	19242068	Associate	★☆☆☆☆ Found in Text Mining only
Asbestosis	Asbestosis	Pubtator	19064360, 23984360	Associate	★☆☆☆☆ Found in Text Mining only
Asbestosis	Asbestosis	BEFREE	23984360		★☆☆☆☆ Found in Text Mining only
Asphyxia Neonatorum	Postnatal asphyxia	CTD_human_DG	17963755		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	16385446, 16630148, 18048809, 19373626, 19897513, 21829032, 22094818, 23827365, 24824229, 25931357, 27956146, 29580563, 31152798, 8568107		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	16385446, 18048809, 19897513, 23066387, 29504915	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	18048809		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	CTD_human_DG	18048809		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	15836927		★☆☆☆☆ Found in Text Mining only
Asymmetric Diabetic Proximal Motor Neuropathy	Asymmetric Diabetic Proximal Motor Neuropathy	CTD_human_DG	10780678		★☆☆☆☆ Found in Text Mining only
Ataxia	Ataxia	Pubtator	23108985	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	2546689, 3000576, 9288786		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	25882094	Stimulate	★☆☆☆☆ Found in Text Mining only
Ataxia, Spinocerebellar	Spinocerebellar Ataxia	BEFREE	10434311		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	15528470, 19409565, 21170678, 23055364, 29793330, 30599319		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	28865890		★☆☆☆☆ Found in Text Mining only
ATRIAL SEPTAL DEFECT 1	Atrial Septal Defect	BEFREE	30999121		★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	BEFREE	30999121		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	28664398, 28740391		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	29782990, 30999121		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	CTD_human_DG	15205966		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	31522454		★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	19497990		★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	BEFREE	28436704		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	27864821, 28678054, 28944912, 29223124, 29485914, 29538305, 30138604, 30262300, 30537571, 31212291, 31652453		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	15884106	Stimulate	★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	24852569		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	24852569	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	CTD_human_DG	12074830		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	CTD_human_DG	21854796		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	31797688		★☆☆☆☆ Found in Text Mining only
BESTROPHINOPATHY, AUTOSOMAL RECESSIVE	Bestrophinopathy	BEFREE	29049981		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	21985133, 22286031, 25772105		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	40004059	Associate	★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	21985133, 22286031, 25772105		★☆☆☆☆ Found in Text Mining only
Bilateral Wilms Tumor	Wilms tumor	BEFREE	2988163		★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	31590928	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	23140658		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	BEFREE	29736827, 31827713		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	28179340		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	29110832		★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom Syndrome	BEFREE	28850077		★☆☆☆☆ Found in Text Mining only
Bonnevie-Ullrich Syndrome	Turner syndrome	CTD_human_DG	25101153		★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	BEFREE	29344828		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	CTD_human_DG	17564305		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	29550901		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	18682580		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	LHGDN	18682580		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	18682580	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15705913, 16192345, 18483329, 18611262, 19255063, 19383545, 21689642, 21920899, 22130631, 22525041, 22551313, 22749807, 23053794, 23883585, 25248722, 26130326, 26700111, 26970563, 2825673, 28280522, 28733879, 29075792, 29535798, 30315444, 31537178, 9060958, 9658402		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	25322848		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19255063, 22551313, 23053794, 23883585, 29535798, 32920119, 35763649, 37774083	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23053794	Inhibit	★☆☆☆☆ Found in Text Mining only
Brittle diabetes	Brittle diabetes mellitus	CTD_human_DG	15111504		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	22958044		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	2157069		★☆☆☆☆ Found in Text Mining only
Carbamoyl-Phosphate Synthase I Deficiency Disease	Carbamoyl Phosphate Synthase Deficiency	BEFREE	30261666		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21198296, 27876813	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10357777, 9669809		★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	26847304	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	27057281	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12716464, 15526362, 18047476, 21985966, 25837767, 3375054, 40179431	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25361011	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27227932	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28179340		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	24074040		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11731445, 17409931, 17548672, 24583396, 25866291, 28270083, 29173487, 29565268, 29616356, 8615594		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	28884887	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36360294	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15899547, 26301412, 28884887		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	10618301, 24874428, 28629836, 30057670		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	CTD_human_DG	11800590		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies, Primary	Cardiomyopathy	CTD_human_DG	11800590		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	36070401	Inhibit	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	28643395, 29462717		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	11350569, 22167619, 30487467, 31485173		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	36012132	Associate	★☆☆☆☆ Found in Text Mining only
Carney Complex	Carney Complex	BEFREE	29574804		★☆☆☆☆ Found in Text Mining only
Cartilage-hair hypoplasia	Cartilage-Hair Hypoplasia	BEFREE	28413915		★☆☆☆☆ Found in Text Mining only
Catalase deficiency	Acatalasia	ORPHANET_DG	11001624		★☆☆☆☆ Found in Text Mining only
Catalase deficiency	Acatalasia	CTD_human_DG	11001624, 11117918, 1551654, 2308162, 26074427		★☆☆☆☆ Found in Text Mining only
Catalase deficiency	Acatalasia	BEFREE	15771551, 15800961, 1962859, 23207165		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	21921984	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	23781296	Inhibit	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	27160797, 28397146, 28699324, 29587970, 30259675, 30965074		★☆☆☆☆ Found in Text Mining only
Cerebellar cortical atrophy	Cerebellar cortical atrophy	BEFREE	4025624		★☆☆☆☆ Found in Text Mining only
Cerebellar Hypoplasia	Cerebellar Hypoplasia	BEFREE	7246619		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	30957616		★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	27302388, 28379484, 31726912, 31819411		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29399074		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	25307973, 27034707, 8137827		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	18941377, 28774741		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	25307973, 27034707, 8137827, 9935152		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	28306688, 9373171		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	28356940		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	34320944	Associate	★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	29180269, 9649223	Associate	★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	GWASCAT_DG	26974007		★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	30194197		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	30194197		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	CTD_human_DG	27989131		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	30177465, 30879149		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	2823116, 8603036		★☆☆☆☆ Found in Text Mining only
Choroid Plexus Papilloma	Choroid Plexus Papilloma	BEFREE	31816375		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	38278340	Associate	★☆☆☆☆ Found in Text Mining only
Chronic granulomatous disease	Granulomatous Disease	BEFREE	12498808, 1431553, 18625437, 19874205, 2380349, 28332028, 29168144, 30984725, 31522454, 408453, 6151045, 6227266		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	20508664, 21325350, 22790458, 30260031		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	16467073, 16919984, 17567676, 21721950, 24824229, 27739024, 29386893, 29436160, 30498444, 30746192, 31657060, 31707715		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	17567676		★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	27515707		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	21907168		★☆☆☆☆ Found in Text Mining only
Classical phenylketonuria	Phenylketonuria	BEFREE	30135593		★☆☆☆☆ Found in Text Mining only
Clonic Seizures	Clonic Seizures	CTD_human_DG	18096215, 19616071, 20592767		★☆☆☆☆ Found in Text Mining only
Clumsiness - motor delay	Motor delay	BEFREE	17534573		★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne Syndrome	BEFREE	1719400, 3956512		★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type I	Cockayne Syndrome	BEFREE	29393366		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	19101040	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	30899592		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	20452077		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10958939, 27912148, 28578041, 29241580, 30639613		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	14710363		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22998821, 31652642		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22998821, 33671292, 37313408	Associate	★☆☆☆☆ Found in Text Mining only
Common Migraine	Common Migraine	BEFREE	25818327		★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	25837767		★☆☆☆☆ Found in Text Mining only
Complex partial seizures	Seizure	CTD_human_DG	18096215, 19616071, 20592767		★☆☆☆☆ Found in Text Mining only
Complex Partial Status Epilepticus	Status Epilepticus	CTD_human_DG	15245787, 15752349, 17383094, 18096215		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	20732340, 22849573, 25395496, 7106775		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	28356940		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	15809365, 27647766, 28793058, 30860934		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	16105639		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27414070		★☆☆☆☆ Found in Text Mining only
Corneal dystrophy Avellino type	Corneal dystrophy	Pubtator	19497990	Inhibit	★☆☆☆☆ Found in Text Mining only
Corneal Dystrophy, Juvenile Epithelial of Meesmann	Corneal Dystrophy, Epithelial Of Meesmann	BEFREE	29660650		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	30201310, 30225256, 30600457, 31780142		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	21282351, 27995364, 30201310, 30225256, 30600457, 31780142		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	28533333, 30225256	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	36361563	Inhibit	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	35866783	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	12751697, 30201310, 30225256, 30600457, 31780142		★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Coronary restenosis	Pubtator	35144391	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	26192919, 26974007		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	33882797, 36555526	Associate	★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	BEFREE	30130360		★☆☆☆☆ Found in Text Mining only
Cutis Laxa	Cutis Laxa	BEFREE	8617996		★☆☆☆☆ Found in Text Mining only
Cystathionine beta-Synthase Deficiency Disease	Cystathionine Beta-Synthase Deficiency Disease	BEFREE	18541157		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	22887680, 26615753, 28484941, 31103890		★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	10843060		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	20664554, 28049462, 29673954, 31405216		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	30864851		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	1472018, 20471444, 28554099, 29122333, 29331597, 29386893, 29436160, 29908926, 30072935, 30760194, 30844963, 31342954		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	19272208	Inhibit	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	18164693, 28594010		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	21338322, 22617568, 22712453, 24595557, 24740756, 25772105, 27075629, 27939935, 28008783, 28105508, 28129627, 28323046, 29274590, 29496557, 30021118, 30716018, 31146169, 31622212		★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	17264407	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	28400911	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	33920886	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	CTD_human_DG	11117918		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15771551, 15800961, 17577741, 18353692, 18423055, 21338322, 22617568, 22712453, 24025477, 24595557, 24740756, 24817970, 25772105, 27075629, 27939935, 27992114, 28008783, 28105508, 28129627, 28323046, 29234979, 29274590, 29343259, 29436658, 29496557, 29615288, 29778909, 29993104, 30021118, 30244088, 30296701, 30716018, 30831097, 30906211, 31146169, 31308875, 31545909, 31622212, 31747350, 31827713		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	LHGDN	15800961, 17577741		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	18353692, 24817970, 36012352	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	32926601	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	24913117	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	27575603	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	17264407, 22718504	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	19019194, 32926601	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	11796176, 11899074, 12606529, 15133753, 16453382, 16877492, 24057136, 29320773, 29859283, 29924645, 30057670, 30155878		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	15111504		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Ketosis-Prone	Diabetes Mellitus	CTD_human_DG	15111504		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	10989952, 11350569, 1587533, 16309371, 17264407, 17825092, 22167619, 22718504, 22970972, 23701472, 26345792, 26674569, 28548478, 28630460, 30176313, 30267825, 30505329, 30900957, 31609067		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	15111504, 15531508		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Sudden-Onset	Diabetes Mellitus	CTD_human_DG	15111504		★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	CTD_human_DG	15111504		★☆☆☆☆ Found in Text Mining only
Diabetic Amyotrophy	Diabetic Amyotrophy	CTD_human_DG	10780678		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	BEFREE	15983321		★☆☆☆☆ Found in Text Mining only
Diabetic Asymmetric Polyneuropathy	Diabetic Asymmetric Polyneuropathy	CTD_human_DG	10780678		★☆☆☆☆ Found in Text Mining only
Diabetic Autonomic Neuropathy	Diabetic Autonomic Neuropathy	CTD_human_DG	10780678		★☆☆☆☆ Found in Text Mining only
Diabetic Mononeuropathy	Diabetic Mononeuropathy	CTD_human_DG	10780678		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	17264407, 18821326, 24057136, 28704754, 29751837, 30132841		★☆☆☆☆ Found in Text Mining only
Diabetic Neuralgia	Diabetic Neuralgia	CTD_human_DG	10780678		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	CTD_human_DG	10780678		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	16523188, 25427889, 31557408		★☆☆☆☆ Found in Text Mining only
Diabetic Polyneuropathies	Diabetic polyneuropathy	CTD_human_DG	10780678		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	17264407, 28262614, 28852447, 31186163		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	29410390	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	CTD_human_DG	16081686		★☆☆☆☆ Found in Text Mining only
Diffuse Scleroderma	Scleroderma	BEFREE	17195236		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	10624550, 15670619, 2139757, 25852816		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	23180588	Associate	★☆☆☆☆ Found in Text Mining only
Dyskinesia, Drug-Induced	Dyskinesia	CTD_human_DG	19109989		★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	30813952	Associate	★☆☆☆☆ Found in Text Mining only
Elliptocytosis, Hereditary	Elliptocytosis	BEFREE	2328319		★☆☆☆☆ Found in Text Mining only
Embryopathies	Embryopathy	BEFREE	21252394, 21478259, 26074427		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	28633046		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	1939212, 7988745		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	12372460	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	12372460		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	12372460, 23416363, 25154023, 36013572	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilia-Myalgia Syndrome	Eosinophilia	BEFREE	9076948		★☆☆☆☆ Found in Text Mining only
Epilepsies Myoclonic	Myoclonic epilepsy	Pubtator	29740017	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	22220588	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	28222320		★☆☆☆☆ Found in Text Mining only
Epileptic drop attack	Hypotonic seizures	CTD_human_DG	18096215, 19616071, 20592767		★☆☆☆☆ Found in Text Mining only
Epiretinal Membrane	Epiretinal Membrane	BEFREE	28699324		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	28884887		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	31066116		★☆☆☆☆ Found in Text Mining only
Erysipelas	Erysipelas	BEFREE	28512644		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	32398095	Associate	★☆☆☆☆ Found in Text Mining only
Esophagitis	Esotropia	Pubtator	15884106	Stimulate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	11479740, 15735318, 20020532		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	15735318, 23701472	Associate	★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	Pubtator	15606558	Associate	★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	11598307		★☆☆☆☆ Found in Text Mining only
Familial Mediterranean Fever	Familial mediterranean fever	Pubtator	31957891	Associate	★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	3623559		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	3623559		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	CTD_human_DG	10860543		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	26551085	Stimulate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	7837930		★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	26551085	Stimulate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	24028323, 29718361		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	26990426, 29174446		★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	15574425		★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	22016819		★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	30349851		★☆☆☆☆ Found in Text Mining only
Galactosemias	Galactosemia	Pubtator	23828587	Inhibit	★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	23009611	Associate	★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	CTD_human_DG	1887894		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	17466292		★☆☆☆☆ Found in Text Mining only
Gastroenteritis	Gastroenteritis	BEFREE	2361534, 2778067, 29280425		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	29908307		★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	CTD_human_DG	18096215, 19616071, 20592767		★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Neoplasms	Gestational Trophoblastic Neoplasms	BEFREE	1955373, 9669809		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingival diseases	Pubtator	34204920	Inhibit	★☆☆☆☆ Found in Text Mining only
Glaucoma Angle Closure	Angle closure glaucoma	Pubtator	23961996	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	28547970	Inhibit	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	28547970	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	24215654, 28829657		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24728830, 36035213, 36838582, 38138986	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28676971, 31187913		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28676971, 31187913		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	18682580, 24024139, 30937698		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	CTD_human_DG	21138464		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	36809279	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	15528470		★☆☆☆☆ Found in Text Mining only
Glucocorticoid-remediable aldosteronism	Hyperaldosteronism	BEFREE	31050580, 31600566		★☆☆☆☆ Found in Text Mining only
Glutaric Aciduria III	Glutaric acidemia	BEFREE	31144534		★☆☆☆☆ Found in Text Mining only
Gonadal Dysgenesis, 45,X	Gonadal Dysgenesis	CTD_human_DG	25101153		★☆☆☆☆ Found in Text Mining only
Gonadoblastoma	Gonadoblastoma	BEFREE	6252821, 6309358, 7106775		★☆☆☆☆ Found in Text Mining only
Grand Mal Status Epilepticus	Grand Mal Status Epilepticus	CTD_human_DG	15245787, 15752349, 17383094, 18096215		★☆☆☆☆ Found in Text Mining only
Granulomatous Disease, Chronic, X-Linked	Granulomatous Disease	BEFREE	18625437, 408453		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	31617239		★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	22065933	Associate	★☆☆☆☆ Found in Text Mining only
Hallopeau-Siemens Disease	DYSTROPHIC EPIDERMOLYSIS BULLOSA	BEFREE	8143767		★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	30069621		★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	25484013, 34530960	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	29740017	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	26642319		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	CTD_human_DG	16105639		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	27647766		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	27647766	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	16105639		★☆☆☆☆ Found in Text Mining only
Hemolysis	Hemolysis	Pubtator	17605772, 2491951	Associate	★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	19155520	Associate	★☆☆☆☆ Found in Text Mining only
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	10403847		★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	25837767, 29214184	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	8182056, 8286041, 8602872		★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	24517502		★☆☆☆☆ Found in Text Mining only
Holoprosencephaly	Holoprosencephaly	BEFREE	29726706		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	11313348	Associate	★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia, Neonatal	Hyperbilirubinemia	BEFREE	24232666		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	20627099, 28372462, 28516253, 28623919, 28834687		★☆☆☆☆ Found in Text Mining only
Hyperemia	Hyperemia	CTD_human_DG	10792963		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	12606529, 28668706, 29516429, 30018977, 30155878, 30359759, 30529353, 30843672, 31396301		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	24093550	Inhibit	★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	28962174, 30206943		★☆☆☆☆ Found in Text Mining only
Hyperkeratosis	Hyperkeratosis	BEFREE	14580687		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	28917868, 29476858, 30500505, 31491954, 31730947		★☆☆☆☆ Found in Text Mining only
Hyperpipecolic Acidemia	Hyperpipecolic Acidemia	BEFREE	10632109		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	18353692, 24817970, 25793211, 29504915	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	CTD_human_DG	11479740, 20667508, 21593737, 22228705		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	12751697, 16076760, 18353692, 21053180, 22713485, 23701472, 24491930, 24817970, 25152049, 25793211, 28152009, 28684630, 29496557, 30176313, 31368095, 31827713, 31833621		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	15735318		★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	CTD_human_DG	23391542		★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	29246135, 31281590		★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	30985713	Associate	★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	30486413		★☆☆☆☆ Found in Text Mining only
Hypocatalasemia	Acatalasia	CTD_human_DG	11001624, 11117918, 1551654, 2308162, 26074427		★☆☆☆☆ Found in Text Mining only
Hypocatalasemia	Acatalasia	BEFREE	9187503, 9237564		★☆☆☆☆ Found in Text Mining only
Hypocholesterolemia	Hypocholesterolemia	BEFREE	29074411		★☆☆☆☆ Found in Text Mining only
Hypopigmentation disorder	Hypopigmentation Disorder	BEFREE	11168813		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	27918653, 30467493, 31256343, 31658321		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	19183269	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21477371, 33725925, 40222298	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	23812845	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	27302388, 28222320		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	39313791	Inhibit	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	22406441, 29264389, 30899592		★☆☆☆☆ Found in Text Mining only
Infantile Refsum Disease (disorder)	Infantile Refsum Disease	BEFREE	12851857, 1430210		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	26198800	Associate	★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	36592993	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	26192919		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	27322626, 29312611, 29531307, 29753375, 30319243		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	29180269, 33028732	Inhibit	★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	18164693, 28594010		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	23641975, 36044932	Associate	★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	8855374		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	2347591		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	36972403	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	30590313		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	25307973		★☆☆☆☆ Found in Text Mining only
Involutional Depression	Involutional Depression	CTD_human_DG	20471444		★☆☆☆☆ Found in Text Mining only
Involutional paraphrenia	Involutional Paraphrenia	CTD_human_DG	20471444		★☆☆☆☆ Found in Text Mining only
Iron deficiency anemia	Iron deficiency anemia	BEFREE	30926500		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	30117045, 30529624, 31236816		★☆☆☆☆ Found in Text Mining only
Iron-Refractory Iron Deficiency Anemia	Anemia	BEFREE	22286031, 25772105		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	29274540		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28198160		★☆☆☆☆ Found in Text Mining only
Jacksonian Seizure	Jacksonian Seizure	CTD_human_DG	18096215, 19616071, 20592767		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	30680511		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	29064157		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	15728537, 30524988		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	31576926	Associate	★☆☆☆☆ Found in Text Mining only
Keratoma	Keratoma	CTD_human_DG	14580687		★☆☆☆☆ Found in Text Mining only
Keratosis	Keratosis	CTD_human_DG	14580687		★☆☆☆☆ Found in Text Mining only
Keratosis Blennorrhagica	Keratosis Blennorrhagica	CTD_human_DG	14580687		★☆☆☆☆ Found in Text Mining only
Kernicterus	Kernicterus	BEFREE	7198680		★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	CTD_human_DG	24360074		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	11118022, 12606529, 20508664, 23793837, 29309869, 30021118		★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	30879230		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	20360867	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	17151330, 26787049		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	CTD_human_DG	16518626, 19420110		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	27414070		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	33396658	Associate	★☆☆☆☆ Found in Text Mining only
Learning Disorders	Learning Disorders	BEFREE	28740391		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	29670896		★☆☆☆☆ Found in Text Mining only
Left ventricular systolic dysfunction	Ventricular Systolic Dysfunction	BEFREE	29521061		★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	16105639		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	23812845	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	27566554, 29467184, 36112236	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29286103		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	18368408		★☆☆☆☆ Found in Text Mining only
Libman-Sacks Disease	Nonbacterial verrucal endocardiosis	CTD_human_DG	27497885		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	18838881		★☆☆☆☆ Found in Text Mining only
Lipid Metabolism Disorders	Lipid Metabolism Disorders	BEFREE	31794270		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10594930, 10713700, 19731237, 19929244, 21985966, 22475485, 2541537, 25837767, 25894370, 26416447, 26990426, 28054958, 2825673, 30925457, 31069844, 31141523, 8247401, 8383844, 8654943		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	21907168, 25837767		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	25837767	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	BEFREE	19731237		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	CTD_human_DG	23274713		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	25361011, 37759451	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	10594930, 12089272, 2541537, 2825673, 8247401, 8383844, 8654943		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	LHGDN	12838770		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	31947722	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Obstructive	Lung Diseases	BEFREE	24824229		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	17409931, 31205586, 32648197	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21198296, 26873489	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	18606005		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	18606005	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	18606005		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	15934434, 18368408, 18606005, 20105444, 22736749, 28163154, 31042126, 31475863, 31522454		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	18368408, 18415766		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	CTD_human_DG	27497885		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	18606005		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	16956821		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	16956821, 22522002		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	16956821		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	27935234	Inhibit	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	27935234	Associate	★☆☆☆☆ Found in Text Mining only
Macular dystrophy, corneal type 1	Macular corneal dystrophy	BEFREE	28649515		★☆☆☆☆ Found in Text Mining only
Macular Edema, Cystoid	Cystoid macular edema	BEFREE	28926197		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	CTD_human_DG	20471444		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	24967945		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	PSYGENET_DG	24967945		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	CTD_human_DG	21138464		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	24024139		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15705913, 16192345, 18483329, 18611262, 19255063, 19383545, 21689642, 21920899, 22130631, 22525041, 22749807, 23053794, 23883585, 25248722, 26130326, 26700111, 26970563, 28280522, 28733879, 29075792, 29353416, 29535798, 30315444, 31537178, 9060958, 9658402		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	25322848		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	23009611		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	24074040		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11731445, 17409931, 17548672, 24583396, 25866291, 28270083, 29173487, 29565268, 29616356, 30021118, 8615594		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	18838881		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26301412		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	12649190, 20097730, 28346693		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17548672, 17671214, 22959522, 23773345, 24711484, 25315963, 25576221, 25837760, 27225983, 27449288, 27706591, 28133488, 30322333, 9092797, 9566751		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	11390181, 14580687		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31155951		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	20578902		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28179340		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11731445, 12543247, 15044326, 17113718, 18379781, 1955373, 22551313, 23650932, 24583396, 25837760, 27034707, 27206672, 27225983, 27449288, 27991692, 28006093, 28281569, 28550753, 28665106, 28872373, 28884610, 29353416, 29547353, 29862858, 30194197, 30247918, 30396975, 30410055, 30617135, 31094165, 31439602, 31534494		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CTD_human_DG	21854796		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	25307973, 27034707, 8137827		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10958939, 27912148, 28578041, 29241580, 30639613		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	18469277, 21827848		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	Pubtator	18469277	Associate	★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	25322848		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16192345, 18483329		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	23437041, 29986606, 7604020		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	25322848		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	25322848		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan Syndrome	CTD_human_DG	25101153		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome, Type I	Marfan Syndrome	CTD_human_DG	25101153		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	11171586, 22970236, 27206673	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	15880589, 20564235, 27206672, 27206673, 28877050, 29342889		★☆☆☆☆ Found in Text Mining only
MELAS Syndrome	Melas syndrome	Pubtator	10564713	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	1472018, 20471444, 28554099, 29122333, 29331597, 29386893, 29436160, 29908926, 30072935, 30760194, 31342954		★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	2347591		★☆☆☆☆ Found in Text Mining only
MERRF Syndrome	Myoclonic epilepsy with ragged red fibers	Pubtator	29740017	Associate	★☆☆☆☆ Found in Text Mining only
MERRF Syndrome	Myoclonic epilepsy with ragged red fibers	Pubtator	29740017	Stimulate	★☆☆☆☆ Found in Text Mining only
Mesenteric vascular insufficiency	Mesenteric Vascular Insufficiency	BEFREE	28666685		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	CTD_human_DG	11283936		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	22617568, 23641975, 31372751		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	23641975, 35976206	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	18071340, 27864821, 29448021, 30176313, 30606264, 31049126		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	15193293		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	25818327		★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine with Aura	BEFREE	25818327		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	31356205		★☆☆☆☆ Found in Text Mining only
MILES-CARPENTER X-LINKED MENTAL RETARDATION SYNDROME	MILES-CARPENTER X-Linked MENTAL RETARDATION SYNDROME	BEFREE	24812443		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	31772636		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	10564713, 19543395, 21249229, 33396658, 37726294	Associate	★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	29276216		★☆☆☆☆ Found in Text Mining only
mixed gliomas	Glioma	CTD_human_DG	21138464		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	29681025		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	30006282		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	36361563	Inhibit	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	8246252		★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis I	Mucopolysaccharidosis	BEFREE	17920576		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	27902770	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	18930811		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	26679105, 29276216, 9811889		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	35732787	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sulfatase Deficiency Disease	Multiple Sulfatase Deficiency	BEFREE	31215062		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Facioscapulohumeral	Facioscapulohumeral muscular dystrophy	Pubtator	22796148	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	27566554, 29774100, 31617242		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	27077777		★☆☆☆☆ Found in Text Mining only
Myocardial Diseases, Secondary	Myocardial Diseases	CTD_human_DG	11800590		★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	16105639		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	21600015		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29805539, 29975120, 30233413, 30304133		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	17264407		★☆☆☆☆ Found in Text Mining only
Myocardial Stunning	Myocardial Stunning	BEFREE	9760299		★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	30008435		★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	29993104, 30906211		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	25584923		★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	22564432, 23883585	Associate	★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	29605607		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11731445, 12604716, 14710363, 1472018, 1505059, 15899547, 16520238, 1847262, 19804819, 21605374, 21920899, 22285198, 23954456, 25275027, 2550179, 26140730, 27328417, 27840167, 28179303, 28346693, 28733879, 28884887, 28925921, 29679806, 3000576, 30096565, 30198041, 30247918, 30303384, 30663118, 30742987, 31252049, 31291092, 31309656, 31534494, 31537178, 31578342, 31763809, 31781331, 31793717, 31808470, 7604020, 7861463, 8126081, 8608838, 9288786, 9454893, 9685222		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CTD_human_DG	21854796		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	1682278, 2347591, 2536636, 2852164, 30530043, 6252821, 6273073, 6301974, 6309358, 6325323, 7106775, 7522041		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis Calcium Oxalate	Nephrolithiasis	Pubtator	37191760	Inhibit	★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	28397206	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	1327147, 15836927, 15904944, 1657967, 19101687, 2252636, 29215880, 30064279, 8468472, 9840920		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	22970236	Inhibit	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	23968537	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	23968537, 30006282, 30663459, 30844963		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	22718504		★☆☆☆☆ Found in Text Mining only
Night blindness congenital stationary	Night blindness, congenital stationary	Pubtator	10702259	Associate	★☆☆☆☆ Found in Text Mining only
Night Blindness Congenital Stationary Autosomal Dominant 3	Night blindness, congenital stationary	Pubtator	10702259	Associate	★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	17671740, 26415102, 28461774, 30120555, 30617744, 30630288, 30974975		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	CTD_human_DG	29718361		★☆☆☆☆ Found in Text Mining only
Non-Convulsive Status Epilepticus	Nonconvulsive status epilepticus	CTD_human_DG	15245787, 15752349, 17383094, 18096215		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	11731445		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31781331, 7585500, 9454893		★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	3164443		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	28652427		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	CTD_human_DG	29718361		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	17242275, 18426959, 23641975, 28683595, 29953407, 31372751, 31737129		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23641975	Inhibit	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23641975, 26123268, 27023799, 28274171, 36044932	Associate	★☆☆☆☆ Found in Text Mining only
Optic Atrophy, Hereditary, Leber	Hereditary Leber Optic Atrophy	BEFREE	29366807		★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic Neuritis	BEFREE	17242675, 9811889		★☆☆☆☆ Found in Text Mining only
Oral Ulcer	Oral Ulcer	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	37879214	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	27919823		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	22089180, 31158803		★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	CTD_human_DG	17227729		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	21308489, 9050993		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	38315381	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26301412		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26301412, 29421935	Associate	★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	24175837		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	12649190, 20097730, 28346693		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	24051964, 28346693, 39942733	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	35745003	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	16047490, 28655148		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	10599447		★☆☆☆☆ Found in Text Mining only
Paratuberculosis	Paratuberculosis	BEFREE	28631071		★☆☆☆☆ Found in Text Mining only
PARIETAL FORAMINA	Parietal Foramina	BEFREE	30316007		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	23620794, 25229627, 28025780, 29068596, 29610454, 31827713, 7492289		★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	28158274, 30026688		★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	23641975, 29953407		★☆☆☆☆ Found in Text Mining only
Pericardial effusion	Pericardial effusion	BEFREE	11181011		★☆☆☆☆ Found in Text Mining only
Pericarditis	Pericarditis	BEFREE	21715584		★☆☆☆☆ Found in Text Mining only
Pericarditis	Pericarditis	Pubtator	21715584	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	31470840, 31640685		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	31470840, 32267380, 34204920	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	30894650, 30982354		★☆☆☆☆ Found in Text Mining only
Peroxisomal Disorders	Peroxisomal disorder	Pubtator	16103719	Associate	★☆☆☆☆ Found in Text Mining only
PEROXISOME BIOGENESIS DISORDER, COMPLEMENTATION GROUP A	Zellweger Syndrome	BEFREE	30183786, 9288786		★☆☆☆☆ Found in Text Mining only
Peroxisome Biogenesis Disorder, Complementation Group D	Zellweger Syndrome	BEFREE	18625437, 408453		★☆☆☆☆ Found in Text Mining only
Peroxisome biogenesis disorders	Zellweger Syndrome	BEFREE	10567403, 15184617		★☆☆☆☆ Found in Text Mining only
Petit mal status	Petit Mal Status	CTD_human_DG	15245787, 15752349, 17383094, 18096215		★☆☆☆☆ Found in Text Mining only
Pfaundler-Hurler Syndrome	Pfaundler-Hurler Syndrome	BEFREE	17920576		★☆☆☆☆ Found in Text Mining only
Phenylketonurias	Phenylketonuria	BEFREE	30135593		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	2892276		★☆☆☆☆ Found in Text Mining only
Phobic anxiety disorder	Phobic Anxiety Disorder	CTD_human_DG	15309392		★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	3644237		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	29055959	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	30206965, 30636259, 31217802, 31781040		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	36593322	Inhibit	★☆☆☆☆ Found in Text Mining only
Polyneuropathy	Polyneuropathy	BEFREE	26674569		★☆☆☆☆ Found in Text Mining only
Porphyria Acute Intermittent	Porphyria	Pubtator	27788171	Associate	★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	24817970, 28554099, 31734707		★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	BEFREE	30818059		★☆☆☆☆ Found in Text Mining only
Primary amyloidosis	Amyloidosis	BEFREE	28623112		★☆☆☆☆ Found in Text Mining only
Primary angle-closure glaucoma	Angle closure glaucoma	BEFREE	23961996		★☆☆☆☆ Found in Text Mining only
Primary Hyperthyroidism	Hyperthyroidism	CTD_human_DG	23391542		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	30570876		★☆☆☆☆ Found in Text Mining only
Primary Progressive Aphasia (disorder)	Aphasia	BEFREE	30019266		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17548672, 17671214, 22959522, 23773345, 24711484, 25315963, 25576221, 25837760, 27225983, 27706591, 28133488, 30322333, 30583431, 9092797, 9566751		★☆☆☆☆ Found in Text Mining only
Prostatic Diseases	Prostatic Diseases	BEFREE	23363810		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	24711484, 27197287, 27706591, 27993795, 28069826, 29697282	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	35488328	Inhibit	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	LHGDN	12165738		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	CTD_human_DG	12559600		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	21989138, 31321579		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	GWASCAT_DG	26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	27864821		★☆☆☆☆ Found in Text Mining only
Psychosis, Involutional	Psychosis	CTD_human_DG	20471444		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	17567676	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	21309732, 29506519, 31564855	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	24824229		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	19684199		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31072167, 31608667		★☆☆☆☆ Found in Text Mining only
Pulmonary Thromboembolisms	Pulmonary thromboembolism	CTD_human_DG	2510358		★☆☆☆☆ Found in Text Mining only
Pustulosis of Palms and Soles	Palmoplantar Pustules	CTD_human_DG	12559600		★☆☆☆☆ Found in Text Mining only
Pyelonephritis	Pyelonephritis	BEFREE	21900516		★☆☆☆☆ Found in Text Mining only
RAINE SYNDROME	RAINE SYNDROME	BEFREE	31039145		★☆☆☆☆ Found in Text Mining only
Refsum Disease	Refsum Disease	BEFREE	10632109		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27414070		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	29915018		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	29702030		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	22958044		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	19897513	Associate	★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	22958044		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	11738881, 26469135		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	15988600, 18313405, 19242068, 28429194, 29934747, 30002993, 30021375, 30077371, 31494513, 31747811		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	18415766		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	22450443		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	15753209, 24962673, 28108375, 31187451, 31522454		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	21871117	Inhibit	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	19560517, 23212700, 28945759, 29782958, 30498208, 31827713		★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	1520334		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	26787049	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	26787049, 28167245, 30340097		★☆☆☆☆ Found in Text Mining only
Severe Aplastic Anemia	Anemia	BEFREE	31011401		★☆☆☆☆ Found in Text Mining only
Single Seizure	Seizure	CTD_human_DG	18096215, 19616071, 20592767		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	14580687		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	12730222	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Central	Sleep Apnea	BEFREE	29393366		★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	19723109	Inhibit	★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	26198800	Associate	★☆☆☆☆ Found in Text Mining only
SPHEROCYTOSIS, TYPE 1 (disorder)	Spherocytosis	BEFREE	30244382		★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	26643950		★☆☆☆☆ Found in Text Mining only
Spinal stenosis of lumbar region	Spinal Stenosis Of Lumbar Region	BEFREE	30985713		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 1	Spinocerebellar Ataxia	BEFREE	10424816, 11346374, 15292212, 15574425		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 2	Spinocerebellar Ataxia	BEFREE	28659860		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxias	Spinocerebellar ataxia	Pubtator	10424816, 15574425, 34635619	Associate	★☆☆☆☆ Found in Text Mining only
SPONDYLOCARPOTARSAL SYNOSTOSIS SYNDROME	Spondylocarpotarsal Synostosis Syndrome	BEFREE	22323645		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	12447480		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	16520238, 18941377, 27245640, 9348073		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28904321, 29802697	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	25489965		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	29521061		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	CTD_human_DG	15245787, 15752349, 17383094, 18096215		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	27617842		★☆☆☆☆ Found in Text Mining only
Status Epilepticus, Subclinical	Status Epilepticus	CTD_human_DG	15245787, 15752349, 17383094, 18096215		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	CTD_human_DG	10860543		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	22940187, 28713910, 31570745, 7837930		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31155951		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach Diseases	BEFREE	30572194		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	30574618, 37265823	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30114685	Associate	★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	Pubtator	35319668	Associate	★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	31464322		★☆☆☆☆ Found in Text Mining only
Symmetric Diabetic Proximal Motor Neuropathy	Symmetric Diabetic Proximal Motor Neuropathy	CTD_human_DG	10780678		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	1520334		★☆☆☆☆ Found in Text Mining only
Temporomandibular Joint Disorders	Temporomandibular Joint Disorders	BEFREE	29216476		★☆☆☆☆ Found in Text Mining only
Tendinopathy	Tendinopathy	BEFREE	27930691		★☆☆☆☆ Found in Text Mining only
Teratozoospermia	Teratozoospermia	BEFREE	29799283		★☆☆☆☆ Found in Text Mining only
Thalassemia	Thalassemia	Pubtator	29365317	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	18606005	Associate	★☆☆☆☆ Found in Text Mining only
THROMBOCYTOPENIA 1 (disorder)	Thrombocytopenia	BEFREE	30423402		★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	29966585		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	20578902		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	28584708, 30221530		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	20578902		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	29552790	Inhibit	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	32887540	Associate	★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	CTD_human_DG	18096215, 19616071, 20592767		★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	28534982		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	28534982		★☆☆☆☆ Found in Text Mining only
Trichothiodystrophy Syndromes	Trichothiodystrophy	BEFREE	1547519		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29742465		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	33302699	Associate	★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner Syndrome	CTD_human_DG	25101153		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	23425094, 31103874		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	26192919, 26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	24967945		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	30903972		★☆☆☆☆ Found in Text Mining only
Ureteral Calculi	Ureteral Calculi	CTD_human_DG	24360074		★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	LHGDN	17171548		★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	BEFREE	28351163		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	22320976, 25307973, 25889023, 27034707, 8137827	Associate	★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	30003582, 30947966, 31772701, 31781347		★☆☆☆☆ Found in Text Mining only
Variegate Porphyria	Variegate Porphyria	BEFREE	23601071		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	15347773, 15983321, 29923227		★☆☆☆☆ Found in Text Mining only
Venous Insufficiency	Venous insufficiency	Pubtator	23182154	Associate	★☆☆☆☆ Found in Text Mining only
Visceral myopathy familial external ophthalmoplegia	Visceral neuropathy	Pubtator	34070501	Associate	★☆☆☆☆ Found in Text Mining only
Visual seizure	Seizure	CTD_human_DG	18096215, 19616071, 20592767		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	11168813, 15771551, 16630078, 16729966, 17071589, 18315617, 18353692, 20070240, 20613769, 21054578, 21947853, 22058000, 24333267, 24817970, 24825136, 24915010, 25139332, 25152049, 28206724, 28542879, 30583218, 31120146, 31827713, 8274781		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	11168813, 16528352, 17071589, 18353692, 20613769, 24817970, 39337683	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	17943184, 22058000, 9284096	Inhibit	★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	11168813, 15771551, 16630078, 16729966, 17071589, 18315617, 18353692, 20070240, 20613769, 21054578, 21947853, 22058000, 24333267, 24817970, 24825136, 24915010, 25139332, 25152049, 28206724, 28542879, 30583218, 31120146, 31827713, 8274781		★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	37107562	Associate	★☆☆☆☆ Found in Text Mining only
WAGR Syndrome	WAGR Syndrome	BEFREE	2574149, 6252821		★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner syndrome	Pubtator	24799429	Associate	★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner Syndrome	BEFREE	7250969		★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	3001710	Associate	★☆☆☆☆ Found in Text Mining only
Wolman Disease	Wolman Disease	BEFREE	9633819		★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma pigmentosum	Pubtator	11370283	Inhibit	★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma Pigmentosum	BEFREE	11390181, 1547519, 1719400, 18202716, 2546689, 2991746, 3000576, 7986581, 9506892		★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum Complementation Group B	Xeroderma pigmentosum	Pubtator	2995975	Associate	★☆☆☆☆ Found in Text Mining only
XERODERMA PIGMENTOSUM, COMPLEMENTATION GROUP C	Xeroderma Pigmentosum	BEFREE	20403967, 29697282		★☆☆☆☆ Found in Text Mining only
Zellweger Syndrome	Zellweger Syndrome	BEFREE	10942196, 1560037, 3412850, 8618694		★☆☆☆☆ Found in Text Mining only