RIDA (reactive intermediate imine deaminase A)

Gene

• Entrez ID: 10247
• Gene name: Reactive intermediate imine deaminase A
• Gene symbol: RIDA
• Synonyms (NCBI Gene): HRSP12, P14.5, PSP, UK114, hp14.5
• Chromosome: 8
• Chromosome location: 8q22.2

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003723	Function	RNA binding	IEA
GO:0003729	Function	MRNA binding	IDA	30930054
GO:0005515	Function	Protein binding	IPI	30930054, 32296183
GO:0005634	Component	Nucleus	IDA	8973653
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	8973653
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	ISS
GO:0005777	Component	Peroxisome	IEA
GO:0005777	Component	Peroxisome	ISS
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0006402	Process	MRNA catabolic process	IBA
GO:0006402	Process	MRNA catabolic process	IDA	30930054
GO:0006629	Process	Lipid metabolic process	IEA
GO:0010608	Process	Post-transcriptional regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016892	Function	RNA endonuclease activity producing 3'-phosphomonoesters, hydrolytic mechanism	ISS
GO:0017148	Process	Negative regulation of translation	IBA
GO:0017148	Process	Negative regulation of translation	ISS
GO:0019239	Function	Deaminase activity	IBA
GO:0019239	Function	Deaminase activity	TAS
GO:0019518	Process	L-threonine catabolic process to glycine	TAS
GO:0061157	Process	MRNA destabilization	IDA	30930054
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337
GO:0080090	Process	Regulation of primary metabolic process	IEA
GO:0120241	Function	2-iminobutanoate/2-iminopropanoate deaminase	IEA
GO:0120242	Function	2-iminobutanoate deaminase activity	IEA
GO:0120243	Function	2-iminopropanoate deaminase activity	IEA

Other IDs

• MIM: 602487
• HGNC: 16897
• e!Ensembl: ENSG00000132541

Protein

• UniProt ID: P52758
• Protein name: 2-iminobutanoate/2-iminopropanoate deaminase (EC 3.5.99.10) (14.5 kDa translational inhibitor protein) (hp14.5) (p14.5) (Heat-responsive protein 12) (Reactive intermediate imine deaminase A homolog) (Translation inhibitor L-PSP ribonuclease) (UK114 antige
• Protein function: Catalyzes the hydrolytic deamination of enamine/imine intermediates that form during the course of normal metabolism. May facilitate the release of ammonia from these potentially toxic reactive metabolites, reducing their impact on cellular comp
• PDB: 1ONI
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01042	Ribonuc_L-PSP	11 → 129	Endoribonuclease L-PSP	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed predominantly in liver and kidney. Lower levels in lung and brain. {ECO:0000269|PubMed:8973653, ECO:0000269|PubMed:9141440}.
• Sequence:

  MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGGVAEEAKQALK
  NMGEILKAAGCDFTNVVKTTVLLADINDFNTVNEIYKQYFKSNFPARAAYQVAALPKGSR
  IEIEAVAIQGPLTTASL

• Sequence length: 137

Pathways

Reactome:

Threonine catabolism

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
LIVER FAILURE, ACUTE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRION DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	15727931		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	24069258		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	29419656		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	29419656		★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder	Attention Deficit Hyperactivity Disorder	BEFREE	10532621		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	10532621		★☆☆☆☆ Found in Text Mining only
Autonomic nervous system disorders	Autonomic Central Nervous System Diseases	BEFREE	31216016		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	28343053		★☆☆☆☆ Found in Text Mining only
Corticobasal degeneration	Corticobasal Degeneration	BEFREE	14502653, 15641585, 28207803		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	14502653		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28343053		★☆☆☆☆ Found in Text Mining only
Deuteranomaly	Deuteranomaly	BEFREE	15641585		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28568564, 30914711		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28568564, 30914711		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	39838413	Associate	★☆☆☆☆ Found in Text Mining only
Dysautonomia	Dysautonomia	BEFREE	31216016		★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	23254636, 24086739, 28501823		★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	31191295		★☆☆☆☆ Found in Text Mining only
Gastroenteritis	Gastroenteritis	BEFREE	26248054, 28238388		★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	31091873		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	26916334, 28467028		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	15101498		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23484134		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30240355		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28343053		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	BEFREE	31216016		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15727931, 24069258		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	28467028, 30726566		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	35733354	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	20083340, 27614955, 29157745, 29463454, 30068492, 31299107		★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	28150443, 28714593		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	15641585, 24086739, 31191295		★☆☆☆☆ Found in Text Mining only
PNEUMOTHORAX, PRIMARY SPONTANEOUS	Pneumothorax	BEFREE	24121548, 28500751, 30399478, 30955098		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	14502653		★☆☆☆☆ Found in Text Mining only
Primary Progressive Aphasia (disorder)	Aphasia	BEFREE	23254636		★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	14502653, 15101498, 16000317, 24121548, 27614955, 28467028, 28500751, 28951832, 29157745, 29463454, 29801913, 30068492, 30158953, 30399478, 30726566, 30955098, 31191295		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23484134		★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	BEFREE	28374985, 29705767		★☆☆☆☆ Found in Text Mining only
Rectal Prolapse	Rectal Prolapse	BEFREE	28374985		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	10532621		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	31621373		★☆☆☆☆ Found in Text Mining only
Spontaneous pneumothorax	Spontaneous pneumothorax	BEFREE	28386166		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	30398966		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	14502653, 15641585, 24086739, 28500751, 31191295		★☆☆☆☆ Found in Text Mining only
Vertical supranuclear gaze palsy	Supranuclear gaze palsy	BEFREE	30068492		★☆☆☆☆ Found in Text Mining only
Wolfram Syndrome	Wolfram Syndrome	BEFREE	30914711		★☆☆☆☆ Found in Text Mining only