CDK8 (cyclin dependent kinase 8)

Gene

• Entrez ID: 1024
• Gene name: Cyclin dependent kinase 8
• Gene symbol: CDK8
• Synonyms (NCBI Gene): IDDHBA, K35
• Chromosome: 13
• Chromosome location: 13q12.13
• Summary: This gene encodes a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are known to be important regulators of cell cycle progression. This kinase and its regulatory subunit, cyclin C, are components of the Mediator transcripti

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1565977796	C>A,T	Pathogenic	Intron variant, missense variant, genic upstream transcript variant, coding sequence variant, 5 prime UTR variant, stop gained
rs1593218885	C>G	Pathogenic	Genic upstream transcript variant, 5 prime UTR variant, coding sequence variant, missense variant
rs1593218890	G>A	Pathogenic	Genic upstream transcript variant, 5 prime UTR variant, coding sequence variant, missense variant
rs1593310364	A>G	Pathogenic	Coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001021	hsa-miR-26a-5p	Western blot	18713946
MIRT047736	hsa-miR-10a-5p	CLASH	23622248
MIRT041203	hsa-miR-193b-3p	CLASH	23622248
MIRT054138	hsa-miR-107	Luciferase reporter assay, qRT-PCR, Western blot	25163571
MIRT054138	hsa-miR-107	Luciferase reporter assay, qRT-PCR, Western blot	25163571
MIRT735543	hsa-miR-567	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry	33911969
MIRT737298	hsa-miR-592	Luciferase reporter assay, Western blotting	32945439
MIRT737298	hsa-miR-592	Luciferase reporter assay, Western blotting	32945439
MIRT756160	hsa-miR-26b-5p	Luciferase reporter assay, Western blotting, qRT-PCR	37205919
MIRT881485	hsa-miR-548g	CLIP-seq
MIRT1961119	hsa-miR-101	CLIP-seq
MIRT1961120	hsa-miR-1273g	CLIP-seq
MIRT1961121	hsa-miR-1297	CLIP-seq
MIRT1961122	hsa-miR-144	CLIP-seq
MIRT1961123	hsa-miR-181a	CLIP-seq
MIRT1961124	hsa-miR-181b	CLIP-seq
MIRT1961125	hsa-miR-181c	CLIP-seq
MIRT1961126	hsa-miR-181d	CLIP-seq
MIRT1961127	hsa-miR-26a	CLIP-seq
MIRT1961128	hsa-miR-26b	CLIP-seq
MIRT1961129	hsa-miR-323b-5p	CLIP-seq
MIRT1961130	hsa-miR-3613-5p	CLIP-seq
MIRT1961131	hsa-miR-4262	CLIP-seq
MIRT1961132	hsa-miR-4465	CLIP-seq
MIRT2197890	hsa-miR-103a	CLIP-seq
MIRT2197891	hsa-miR-1179	CLIP-seq
MIRT2197892	hsa-miR-1184	CLIP-seq
MIRT2197893	hsa-miR-1243	CLIP-seq
MIRT1961121	hsa-miR-1297	CLIP-seq
MIRT2197894	hsa-miR-148a	CLIP-seq
MIRT2197895	hsa-miR-148b	CLIP-seq
MIRT2197896	hsa-miR-152	CLIP-seq
MIRT1961127	hsa-miR-26a	CLIP-seq
MIRT1961128	hsa-miR-26b	CLIP-seq
MIRT2197897	hsa-miR-3165	CLIP-seq
MIRT2197898	hsa-miR-3173-5p	CLIP-seq
MIRT2197899	hsa-miR-33a	CLIP-seq
MIRT2197900	hsa-miR-33b	CLIP-seq
MIRT2197901	hsa-miR-3654	CLIP-seq
MIRT2197902	hsa-miR-3688-3p	CLIP-seq
MIRT2197903	hsa-miR-4310	CLIP-seq
MIRT2197904	hsa-miR-4420	CLIP-seq
MIRT1961132	hsa-miR-4465	CLIP-seq
MIRT2197905	hsa-miR-4539	CLIP-seq
MIRT2197906	hsa-miR-4638-3p	CLIP-seq
MIRT2197907	hsa-miR-4677-3p	CLIP-seq
MIRT2197908	hsa-miR-4679	CLIP-seq
MIRT2197909	hsa-miR-4690-3p	CLIP-seq
MIRT2197910	hsa-miR-4709-5p	CLIP-seq
MIRT2197911	hsa-miR-4796-3p	CLIP-seq
MIRT2197912	hsa-miR-548p	CLIP-seq
MIRT2197913	hsa-miR-548t	CLIP-seq
MIRT2197914	hsa-miR-558	CLIP-seq
MIRT2197915	hsa-miR-562	CLIP-seq
MIRT2197916	hsa-miR-586	CLIP-seq
MIRT2197917	hsa-miR-622	CLIP-seq
MIRT2197918	hsa-miR-668	CLIP-seq
MIRT1961123	hsa-miR-181a	CLIP-seq
MIRT1961124	hsa-miR-181b	CLIP-seq
MIRT1961125	hsa-miR-181c	CLIP-seq
MIRT1961126	hsa-miR-181d	CLIP-seq
MIRT2446733	hsa-miR-27a	CLIP-seq
MIRT2446734	hsa-miR-27b	CLIP-seq
MIRT1961131	hsa-miR-4262	CLIP-seq
MIRT2446735	hsa-miR-4749-3p	CLIP-seq
MIRT2446736	hsa-miR-513a-5p	CLIP-seq
MIRT1961121	hsa-miR-1297	CLIP-seq
MIRT1961127	hsa-miR-26a	CLIP-seq
MIRT1961128	hsa-miR-26b	CLIP-seq
MIRT2197899	hsa-miR-33a	CLIP-seq
MIRT2197900	hsa-miR-33b	CLIP-seq
MIRT2197902	hsa-miR-3688-3p	CLIP-seq
MIRT2197904	hsa-miR-4420	CLIP-seq
MIRT1961132	hsa-miR-4465	CLIP-seq
MIRT2197905	hsa-miR-4539	CLIP-seq
MIRT2197912	hsa-miR-548p	CLIP-seq
MIRT2197915	hsa-miR-562	CLIP-seq
MIRT2197916	hsa-miR-586	CLIP-seq
MIRT2197917	hsa-miR-622	CLIP-seq
MIRT2197918	hsa-miR-668	CLIP-seq
MIRT1961121	hsa-miR-1297	CLIP-seq
MIRT1961127	hsa-miR-26a	CLIP-seq
MIRT1961128	hsa-miR-26b	CLIP-seq
MIRT2197899	hsa-miR-33a	CLIP-seq
MIRT2197900	hsa-miR-33b	CLIP-seq
MIRT2197904	hsa-miR-4420	CLIP-seq
MIRT1961132	hsa-miR-4465	CLIP-seq
MIRT2197905	hsa-miR-4539	CLIP-seq
MIRT2197916	hsa-miR-586	CLIP-seq
MIRT2197917	hsa-miR-622	CLIP-seq
MIRT2197918	hsa-miR-668	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IDA	21806996
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	IMP	30905399
GO:0004672	Function	Protein kinase activity	TAS	7568034
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	7568034, 15546612, 18794899, 19047373, 19914168, 20098423, 21806996, 23602568, 23746844, 25344755, 25416956, 26502155, 29568061, 29997244, 32707033, 32814053, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	16109376
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA	22869755
GO:0008353	Function	RNA polymerase II CTD heptapeptide repeat kinase activity	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016592	Component	Mediator complex	IDA	14638676
GO:0016592	Component	Mediator complex	IEA
GO:0016592	Component	Mediator complex	IMP	30905399
GO:0016740	Function	Transferase activity	IEA
GO:0032991	Component	Protein-containing complex	IDA	22869755
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	15009212
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1990508	Component	CKM complex	IPI	19047373

Other IDs

• MIM: 603184
• HGNC: 1779
• e!Ensembl: ENSG00000132964

Protein

• UniProt ID: P49336
• Protein name: Cyclin-dependent kinase 8 (EC 2.7.11.22) (EC 2.7.11.23) (Cell division protein kinase 8) (Mediator complex subunit CDK8) (Mediator of RNA polymerase II transcription subunit CDK8) (Protein kinase K35)
• Protein function: Component of the Mediator complex, a coactivator involved in regulated gene transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal R
• PDB: 3RGF, 4CRL, 4F6S, 4F6U, 4F6W, 4F70, 4F7J, 4F7L, 4F7N, 4F7S, 4G6L, 5BNJ, 5CEI, 5FGK, 5HBE, 5HBH, 5HBJ, 5HNB, 5HVY, 5I5Z, 5ICP, 5IDN, 5IDP, 5XQX, 5XS2, 6QTG, 6QTJ, 6R3S, 6T41, 6TPA, 6Y0A, 8TQ2, 8TQC, 8TQW, 9H8C, 9H8S
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	22 → 335	Protein kinase domain	Domain

• Sequence:

  MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGIS
  MSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKP
  VQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLF
  NSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQED
  IKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKH
  KVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLT
  EEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTS
  DYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY

• Sequence length: 464

Pathways

Reactome:

PPARA activates gene expression
Generic Transcription Pathway
SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription
Constitutive Signaling by NOTCH1 PEST Domain Mutants
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
Transcriptional regulation of white adipocyte differentiation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Complex neurodevelopmental disorder with or without congenital anomalies	Pathogenic	rs1565977796	RCV003994184	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intellectual developmental disorder with hypotonia and behavioral abnormalities	Likely pathogenic; Pathogenic	rs2137842716, rs2138050429, rs1565977796, rs1593218885, rs1593218890, rs1875421510, rs1593310364, rs1011754140, rs1875421918	RCV002464991 RCV002509898 RCV004555461 RCV000993854 RCV000993855 RCV000993856 RCV000993857 RCV000993858 RCV001262767 RCV001290425	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, DILATED	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CDK8-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMMON ATRIUM	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL DIAPHRAGMATIC HERNIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DEFECTS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUPUYTREN CONTRACTURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSLEXIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBSTEIN ANOMALY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual disability	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet, Orphanet Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	31628323		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	31382571		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Agenesis of Corpus Callosum	Corpus callosum agenesis	Pubtator	30905399	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	31653719		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24427329, 25818643, 26452386, 28147342, 31382571		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24427329, 31382571, 33173974, 33291686, 33686962	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28416637	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32354935	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	38129817	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	23562092		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28771672		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19790197, 19808961, 22104393, 22379099, 25305448, 26349978, 29967145, 30185549		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	18794900, 19790197, 20454513, 21179167, 21352556, 22035865, 23454913, 27789274, 28191946, 29737445		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18794899, 18794900, 19790197, 22104393, 22379099, 29117556, 29955133, 33291686	Associate	★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	BEFREE	28768905		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	30905399		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	30905399	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	18840782	Associate	★☆☆☆☆ Found in Text Mining only
Ebstein Anomaly	Ebstein anomaly of the tricuspid valve	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	23454913		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	40500968	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30524203		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	GENOMICS_ENGLAND_DG	30905399		★☆☆☆☆ Found in Text Mining only
Hearing Disorders	Headache	Pubtator	30905399	Associate	★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	30905399	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28768905		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	29266937		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	31509750		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	23746844	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	31653719		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	GENOMICS_ENGLAND_DG	30905399		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Intellectual Disability	Intellectual developmental disorder	Pubtator	30905399	Associate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	28220308		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	27889101, 35418189, 35559861	Associate	★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	27389556		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	31628323		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	32705162	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	31382571, 33291686	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	26416749, 29239838, 31382571, 31628323		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29653269, 30967300		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24427329, 25818643, 26452386, 28147342, 31382571		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	23454913		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25305448, 29856990		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27678455, 29568371, 31271443		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18794900, 22035865, 26006748, 27678455, 28855340, 29266937, 29386186, 29856990, 30594029, 30693281, 31382571, 31717492		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18794900, 19790197, 19808961, 22104393, 22379099, 25305448, 26349978, 29967145, 30185549		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21179167, 22035865, 23454913		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	22379099	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	28151579	Associate	★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	GWASDB_DG	19629137		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	33577031	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16969500, 19790197, 20083228, 22104393, 23454913, 25818643, 26452386, 27389556, 29386186, 30185549, 31331961, 31520353		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	36398965	Associate	★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	26042770		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25400821		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	31520353		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	28147342		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	22379099, 28416637		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	22379099	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	28416637	Inhibit	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25305448, 29856990		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	29119056		★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	GWASCAT_DG	26029870		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	36233050	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27678455, 29568371, 31271443		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31382571, 39253786	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24504440		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	30905399	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25163571	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	32945439	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31622095		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	33291686	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	16780590	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	29440396, 30099503		★☆☆☆☆ Found in Text Mining only